KEGG   Burkholderia diffusa: WI26_15480Help
Entry
WI26_15480        CDS       T04698                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bdf  Burkholderia diffusa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR Glyco_trans_4_4 Glyco_transf_4 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AOI59107
UniProt: A0A1B4BWQ0
LinkDB All DBs
Position
2:complement(24525..25247)
Genome map
AA seq 240 aa AA seqDB search
MNRPWSFEGKTVVVTGGTSGIGARTAWRFAQAGASVVAFGLDTAGPNAPVHPAIRCVELD
VTDGDALTGRIRALPHVDMLVNGVGISRHADEYRMDQFERVLNVNLTSVMRASDAALPAL
SANGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWAERGIRVNAVAPGWIDT
PLSSGLMADTQASRRILDRTPLARWGTADEVAEVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcccctggtcgtttgaaggcaagaccgtcgtcgtgacgggcggcacgtccggc
atcggcgcgcgcaccgcatggcgtttcgcgcaagcgggtgcatcggtcgtcgcgttcggg
ctcgacaccgccggcccgaatgcgccggtgcatcccgccatccgctgcgtcgaactcgac
gtgaccgacggcgatgcattgacgggccggatccgcgcgctgccgcacgtcgacatgctc
gtcaacggcgtcggcatcagccggcacgcggacgaataccggatggaccagttcgagcgg
gtactgaacgtgaacctgacgtcggtgatgcgggcatccgacgccgcgctgccggcactg
tcggcaaacggtggcagcatcgtcaacgtcgcgtcgatgtacacctacttcggcagcaag
gaccgtcctgcatacagcgcaagcaagggcggcatcgcgcagttgacgcgctcgctcgcg
caagcgtgggccgagcgcggcatccgcgtgaatgcggtcgcgcccggctggatcgacacg
ccgctcagcagcgggttgatggccgacacgcaggcgtcgcggcggattctcgaccgcacg
ccgctcgcgcgctggggcacggccgacgaggtcgcggaagtgatcctgttcctgtgctcg
cccggcgcatccttcgtcaccggcgcgatcgtgccggtagacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system