KEGG   Burkholderia diffusa: WI26_15490Help
Entry
WI26_15490        CDS       T04698                                 

Definition
(GenBank) MFS transporter
Organism
bdf  Burkholderia diffusa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like MFS_2 DUF2417
Motif
Other DBs
NCBI-ProteinID: AOI59109
UniProt: A0A1B4BWU5
LinkDB All DBs
Position
2:complement(26348..27640)
Genome map
AA seq 430 aa AA seqDB search
MTSQPSPKLAWTYENRLLVILFMTFGFVFFDRLALSFLFPFMSAELHLSNTQLGMVSSAL
ALTWALSGAATSAWSDARGTRKPLLIAAVLGFSACSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
IPGFLIAFCIWRWVREAPPGGARHTQADSTPPHGAVINRWALLKERNILLCMLISCFFLT
WFIVIISFAPVFLVESRHLSPADMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIMFAL
VAAVCPIVLIHVGSLWALGALVFMTYTGLGCFTLFMATIPAETVPPRAIASALGLIMGAG
ELIGGFVAPTIAGFAADKYGLQFAMWTSAAGAILACVLSFGLVETAPAVLRKRTLDGTAA
RLDTQNLGGR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccaaccttcccccaaactggcgtggacgtacgagaacaggctactcgtgatc
ctgttcatgacgttcggtttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtcggccgaactgcacctgtcgaatacgcaactcggcatggtgtcgtccgcgctc
gcactcacgtgggcgctgtcgggcgccgcgaccagcgcgtggtccgatgcgcgcggcacg
cgcaagccgctgctgatcgccgcggtgctcggtttctccgcatgctcggcgctgtcgggg
ctggtcggcggcttcgcgagcctgatcgcgttccgcgcgctgatgggcatcgccgaaggg
cccgtgctgccgctgtcgcaatcgctgatggtcgagagttcgacgccgagccgccgcggg
ttgaacatgggcctgctgcaaggctccgctgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgcgaccgcctacggctggcgcgaggcgttctacgtgtcgtgc
attcccggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagcgccgcccggc
ggtgcgcgacacacgcaggccgacagcacgcccccgcacggcgcggtgatcaatcgctgg
gcactgctgaaggaacgcaacatcctgctatgcatgctgatcagttgcttcttccttacg
tggttcatcgtgatcatctcgttcgcgccggtctttctcgtcgagagccgccacctgtcg
ccggccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtattttggggcttc
gcggtgccggcgatttccgaccggatcgggcgcaagccgacgatgatcatgttcgcgctg
gttgccgccgtctgcccgatcgtgctgatccatgtcggctcgctgtgggcgctcggcgcg
ctcgtgttcatgacgtacacgggcctcggctgcttcacgctgttcatggcgacgatcccg
gccgaaacggtgccgccccgcgcgatcgccagcgcgctcggcctgatcatgggcgccggc
gagctgatcggcggcttcgtcgcgccgaccatcgccggtttcgcggccgacaagtacggc
ctgcagttcgcgatgtggacgtcggccgccggcgcgatcctcgcgtgcgtgctgtcgttc
ggcctcgtcgaaaccgcgcccgccgtgctgcgcaaacgcacgctcgacggcaccgccgcc
cgactcgatacccaaaacctcggaggacgctga

DBGET integrated database retrieval system