KEGG   Burkholderia diffusa: WI26_16870Help
Entry
WI26_16870        CDS       T04698                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bdf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    WI26_16870
Enzymes [BR:bdf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WI26_16870
Transporters [BR:bdf02000]
 Other Transporters
  Pores ion channels [TC:1]
   WI26_16870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AOI59349
UniProt: A0A1B4BXN0
LinkDB All DBs
Position
2:309040..309657
Genome map
AA seq 205 aa AA seqDB search
MKLYGFAGTRSQRALWGLKELDADFEFVSVNLLEGEHKRPEFLRLNPAGKVPVLVDGDLV
IPESAAIVLYLADKYPEKALLPVDPALRAQAYRWVMFAVTELEQPLWRITRHSFIYPPEK
RSPADIELAREDFATMAAILDTHLEGREFIVGDSLTVADCVTVYLIDWASECHLIEPFPQ
LRAYLERLYARPKAPQRIADARKAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacggattcgccggcacgcgctcgcaacgcgcgctctgggggctcaaggaa
ctggacgcggatttcgagttcgtgtcggtcaacctgctcgagggcgagcacaagcggccc
gaattcctgcgcctcaatccggccggcaaggtgcccgtgctcgtggacggcgacctcgtg
attcccgagtcggccgcgatcgtgctgtatctcgcggacaagtacccggagaaggcgctg
ctgcccgtcgatccggcgctgcgcgcgcaggcctatcggtgggtgatgttcgcggtgacg
gagctcgagcagccgctgtggcggattacgcgccattcgttcatctatccgccggaaaag
cgctcgccagccgatatcgagctggcccgcgaggatttcgcgacgatggccgcgatcctc
gacacgcatctcgaaggacgcgaattcatcgtcggcgattcgttgacggtggccgattgc
gtgacggtctacctgatcgactgggcgagcgaatgccacctgatcgaaccgttcccgcaa
ttgcgcgcgtatctcgagcggctttatgcgcggccgaaggcgccgcagcggatcgcggac
gcgcgcaaggcggcgtga

DBGET integrated database retrieval system