KEGG   Burkholderia diffusa: WI26_19185Help
Entry
WI26_19185        CDS       T04698                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WI26_19185
Enzymes [BR:bdf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WI26_19185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin Thi4 FAD_oxidored K_oxygenase NAD_binding_8 DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AOI59760
UniProt: A0A1B4BYK3
LinkDB All DBs
Position
2:complement(832725..834323)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTSRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFAMALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVTIITQAQTTELTGDGSKL
NGLVYKDLRSGDTKRVDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDAMPAAAEAPQAEEAIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcgtcgctcgacgacagcgcgaaatcgcaggaactgcttgcgctgctg
aacgagattgcgtcgctgacgtcgcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccggtcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactacgca
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcattgttccag
aacgaagtggaggcgcgacagatcatggccgtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaattctcgcgaagctcgacacgggcgccagc
gcccgcgccgccaagtcgctcgagaacaagccggtattcgacacgctgatcgtcggcggc
gggccggccggtgctgccgccgcgatctattcggcacgcaagggaatcgcgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaacggaagggccaaagttcgccatggcactcgaacagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgggccgacgcgctgattcccggcgacgtgcaccag
atccgccttgcgaacggcgcggtgctgaaggcgaagacgatcatcctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcatac
tgcccgcattgcgatggcccgctgttcaaaggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggcggcgatcgacctggccggcatcgtgaaggaagtcacgctgatc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcatcacgcaggcgcagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgttcgggcgacacgaagcgcgtcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacgatcgaactg
tcgaagcatggcgagatcgtcgtcgatgcgcgcggagcgacatcggtacccggcgtgttt
gcggccggcgacgtgacgacggtgccgttcaagcaaatcgtgatcgcggtcggcgaaggc
gcgaaggcgtcgctcggcgcgttcgatcacctgatccggcaagacgcgatgccggctgcc
gccgaggcaccgcaggccgaagaagcgatcgccgcgtaa

DBGET integrated database retrieval system