KEGG   Burkholderia diffusa: WI26_19325Help
Entry
WI26_19325        CDS       T04698                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00440  Phosphonate and phosphinate metabolism
bdf01100  Metabolic pathways
bdf01120  Microbial metabolism in diverse environments
bdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WI26_19325
Enzymes [BR:bdf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WI26_19325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AOI59783
UniProt: A0A1B4BYS2
LinkDB All DBs
Position
2:complement(871339..873024)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQSVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFAQCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtcggcacggatcgtc
cgcgaagccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatcccgatttctcg
atcgtcgcgcgcgtcgaagcgctgatcgccggttggggaatggatgaggcgctgcgccgc
gcaaacgcgtacgcggaagccggcgccgacgcgatcctgattcacagcaagctgtcgcgt
ccggacgagatcctgcagttcgcacgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatcggcaatgcagtccgtcgcacgcgag
atccacgaaaacgagacgctgatcaacgtcgaggatcgcgtcgcatcggtcaacgaaatc
ttccgcctgcaggacgccgacgaatactcggcagccgagcgcatctacctgtcgtcatcg
tcgcgcgcgtcgaacgcggcgatcgtgctcgcggccagccgcggcaaggggctggaagcc
gtcaccgaggacaagcccaaggtcatgctgccggtcgccggcaagccgctcctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcaaacg
ggcgaactcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaagccgag
ttcagcgtcgtcgtcgattcgtcgctcaccgagaccaaccagagcgtgcgcgacttcgcg
cagtgctcggccgctgacgaccgcggcctgttcggtcagaaaacgtatctgcaacgtgta
tcgagcgacgtcgccgcaggcacgccgcacgggcgctggatcggtctgctgaacgtgcgc
ggcgcgggcgtcgaccgcctgaaggcgatgctcgcgacgctgcaggcgcggcccgatttc
gacacgctcgacatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgtggcgtgaacgatctggaagacttccgccgtgcg
ggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system