KEGG   Burkholderia diffusa: WI26_22005Help
Entry
WI26_22005        CDS       T04698                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    WI26_22005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AOI60267
UniProt: A0A1B4C022
LinkDB All DBs
Position
2:complement(1509247..1509987)
Genome map
AA seq 246 aa AA seqDB search
MQTHTLTIVVLVFLLAGAVKGMIGLGLPTIAMGLLTLAMPPSAAASLLLVPSFITNVWQL
WLGPSFGSLLRRLWPLLAGLTIGTLTGGLPALAAGSAWTHAALGVVLVAYGCWGLAAARL
PAPGRYEKWLSAAVGYLTGVVTAATGVFVVPAVPYLQALCLPKDDLIQALGLSFTASTVA
LGLQLRVTGALQTVDLGVSVLALVPALAGMIGGQYARRVMSENAFKRCFFVGMIALGAYM
AVAARL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccatacgctgacgatcgtcgtgctggtctttctgctggccggcgcggtcaag
ggcatgatcggcctcgggctgccgacgatcgcgatggggctgttgacgcttgcgatgccg
ccgtcggccgccgcgagcctgttgctcgtgccgtcgttcatcaccaatgtgtggcagctg
tggctcggcccgtcgttcggctcattgctgcggcgtctgtggccgctgctcgccgggctg
acgatcggcacgctgacgggcgggctgcccgcgctcgcggccggcagcgcgtggacccac
gcggcactcggcgtcgtgctggtcgcatacggctgctgggggctcgccgccgcgcgactg
cccgcgccgggtcgatacgaaaagtggctgtcggccgcggtcggctatctgacgggcgtc
gtgacggccgcgaccggtgtgttcgtcgtgcccgcggtgccgtacctgcaagcgctgtgc
ctgccgaaggacgacctgatccaggcgctcgggttgtcgtttaccgcgtcaacggtcgcg
ctcgggctgcagttgcgcgtgacgggcgcgctgcagacggtcgatctcggcgtatcggtg
ctggcgctcgtgccggcactcgcggggatgatcggcgggcaatatgcgcggcgcgtgatg
agcgagaacgcgttcaagcgctgcttcttcgtcgggatgatcgcgctcggcgcctacatg
gcggttgcggcgcggctgtga

DBGET integrated database retrieval system