KEGG   Burkholderia diffusa: WI26_25645Help
Entry
WI26_25645        CDS       T04698                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00250  Alanine, aspartate and glutamate metabolism
bdf00410  beta-Alanine metabolism
bdf00640  Propanoate metabolism
bdf00650  Butanoate metabolism
bdf01100  Metabolic pathways
bdf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WI26_25645
   00650 Butanoate metabolism
    WI26_25645
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WI26_25645
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WI26_25645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdf01007]
    WI26_25645
Enzymes [BR:bdf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WI26_25645
Amino acid related enzymes [BR:bdf01007]
 Aminotransferase (transaminase)
  Class III
   WI26_25645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOI60917
UniProt: A0A1B4C1W4
LinkDB All DBs
Position
2:2346546..2347835
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNSFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNSLQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggtcaccgccac
ccgaagatcgtcaaggcgatcgcggatcagctgaacagcttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgaaaagatcaacgaacgcgcgccgggc
gacttcccgaagaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcacgcgcggcaaccggccgtccgggcgtcatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgccccgtacccgaacgcgctgcacggcgtgacg
acggccgactcgatcaaggccatcgaaatgctgttcaaggccgacatcgatccgaagcgc
gtcgcggcgatcattttcgaaccggtccagggcgaaggcggcttcaatccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgatgtg
ctcgccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggcagcccccggcggcctcggcggcacgtacgcg
ggcaacccgctggccgtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagaaaag
ctgtgcgaacgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaattcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggttcgggcgagccggacgcggaattcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcgggctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaggccgtgttcgacgaagcgctcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system