KEGG   Burkholderia diffusa: WI26_26640
Entry
WI26_26640        CDS       T04698                                 

Definition
(GenBank) hypothetical protein
  KO
K11477  glc operon protein GlcG
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    WI26_26640
SSDB
Motif
Pfam: Haem_degrading GAF_2 HTH_15 PocR
Other DBs
NCBI-ProteinID: AOI61095
UniProt: A0A1B4C2F4
LinkDB
Position
2:2574842..2575246
AA seq 134 aa
MKTKPELELADVERMLAAARAEAERHGWAVSIAVVDDGGHLLAFARLDGASAASASIAQD
KARAAALGRRETKAYEDMINGGRTAFLSVPLTGLLEGGVPVTVDGRIAGAIGVSGVKSEQ
DAQIARAGTQSVAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaaacgaagcccgaactcgaactcgccgacgtcgaacgcatgctcgccgccgcccgc
gcggaagccgagcgtcacggctgggccgtgtcgatcgccgtcgtcgacgacggcgggcat
ctgctcgcgttcgcacgcctcgacggtgcgtcggcggccagcgccagcatcgcgcaggac
aaggcgcgcgcggcggcgctcggccgtcgcgagacgaaggcgtatgaggatatgatcaac
ggtggccgcacagcgtttctgagcgtgccgctgacggggttgctcgaaggcggcgtgccg
gtgacggtggatggccgtattgcgggcgcgatcggtgtgtctggcgtaaagtccgaacag
gatgcgcagatcgcccgcgccggcacacaaagcgtcgcggcctga

DBGET integrated database retrieval system