KEGG   Burkholderia diffusa: WI26_26645
Entry
WI26_26645        CDS       T04698                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00620  Pyruvate metabolism
bdf00630  Glyoxylate and dicarboxylate metabolism
bdf01100  Metabolic pathways
bdf01110  Biosynthesis of secondary metabolites
bdf01120  Microbial metabolism in diverse environments
bdf01200  Carbon metabolism
Module
bdf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WI26_26645
   00630 Glyoxylate and dicarboxylate metabolism
    WI26_26645
Enzymes [BR:bdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     WI26_26645
SSDB
Motif
Pfam: Malate_synthase
Other DBs
NCBI-ProteinID: AOI61096
UniProt: A0A1B4C2F5
LinkDB
Position
2:2575282..2577456
AA seq 724 aa
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQQE
LDAWHRAHPGPVRDHAAYRAFLERIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTTAYNPTRGQRVIDYARDVLDNAAPLA
SGSHRDALRYRVEDGQLAVETGKGVVHLAQPAQFVGYQGAAGAPSAILLKHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLTLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTVLCSLHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYNLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKTSAWI
QAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERDALLEGLLTVPVVERAEWSEAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAYKAQ
QRGA
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgccccagcgctgagccagttcattgaaaacgaa
gcactgccgggtaccggcatcgacaaggccgcattctggagcggtttctcggccctggtg
cacgacctcgcgccgcgcaaccgcgaactgctcgcggaacgcgaccgcctgcagcaggaa
ctcgacgcgtggcatcgcgcgcaccccggcccggtgcgcgaccatgccgcgtatcgcgcg
ttcctcgaacgaatcggctacctcgtgccggtcccgtcgaatgtcgcggcagccaccgcg
aacgtcgacagcgagatcgcgacgcaggccggcccgcagctcgtcgtgccgctctcgaac
gcgcgttatgcgctgaacgccgcgaacgcacggtggggcagcctgtacgacgcactgtac
ggcaccgacgcgctgccggaggacggcggcgccgagcgcaccacggcctacaacccgacg
cgcggccagcgcgtgatcgactacgcacgcgacgtgctcgacaacgcggcgccgctcgcg
agcggctcgcaccgcgacgcactgcgctatcgcgtggaagacggccagctcgccgtcgaa
accggcaagggcgtcgtgcacctcgcacagcccgcgcagttcgtcggttatcaaggcgcg
gcaggcgcaccatccgcgattctgctgaagcacaacggcctgcacctcgagatccagatc
gacgcgtcgacccccatcggccgcgccgatctcgcaaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgaagac
aaggttcagctctatcgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgatcgcgaatacacgacgccg
gccggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgaaattccggaagggattctc
gacggcgtcgtcacggtgctgtgctcgctgcacgacctgaaggcgaagcgcaactcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacggccccgtcgaagtcgcgttcgcc
gacacgctcttcgcgcgcatcgaggatctgtacaacctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgtatcgccgcggcc
gccgcgcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagacgtcggcatggatc
caggcgtacgagcgcaacaacgtgctcgccgggctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcatgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcgtgggtgccgtcgccgaccgccgcgacg
ctgcatgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggaactcgaaaag
acgccgtatgcaagcgaacgcgacgcgctgctcgaaggcctgctgaccgtgccggtcgtc
gaacgcgccgagtggagcgaagccgagatcctgagcgaagtcgagaacaacgcgcagggc
atcctcggttacgtcgtgcgctgggtcgagcagggtgtcggttgctcgaaggtaccggac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgtgtcgtcgatcagcagaatgccggcgatccgaactatcgcccgatggcaccc
ggctacgaccagtcgacggcattcaaggccgcgtgcgcgctggcgctgcaaggcacgtcg
cagccgagcggttataccgagccgctgctgcatcgtttccggctcgcatacaaggcgcag
cagcgcggcgcgtaa

DBGET integrated database retrieval system