KEGG   Burkholderia diffusa: WI26_26655
Entry
WI26_26655        CDS       T04698                                 

Definition
(GenBank) histidine kinase
  KO
K02480  two-component system, NarL family, sensor kinase [EC:2.7.13.3]
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bdf01001]
    WI26_26655
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bdf02022]
    WI26_26655
Enzymes [BR:bdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     WI26_26655
Protein kinases [BR:bdf01001]
 Histidine kinases
  NarL family
   WI26_26655
Two-component system [BR:bdf02022]
 NarL family
  Unclassified
   WI26_26655
SSDB
Motif
Pfam: sCache_2 dCache_2 HisKA_3 Cache_3-Cache_2 HATPase_c HATPase_c_2 Exonuc_VII_L sCache_3_2
Other DBs
NCBI-ProteinID: AOI61098
UniProt: A0A1B4C2G1
LinkDB
Position
2:2579687..2581066
AA seq 459 aa
MRLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAYLSSKEVELRHYVELA
TSAIMPLYDASGRNARDDALLRTQALAMLQKMDFGPDGYFFVYDLHGNALMHPREPERVG
HNYWSMRDPQGALTIQQLIGAASRGGGYVRYTWQRPSTGKAAPKLGYVVALERWGWMVGT
GIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAVIAVCALVLNVSESRSADAKLK
QLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALARFERGATRMTEAEQALASG
IGRLGDTLREVRRISHALRPAMLDDLGLAAALEQLVRELGAESGIDIGYTQVAHSGARPL
PAPVNTALFRIAQEALSNIVHHAQASRAAVTLDVGAHSVTLTIADNGCGFDAERSQTDAR
RGIGLRNMRERLDALGGTLTITSQVGHTVVAARVPLRAA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgagactcaaggcaaagattttccttctggccatcgtgccattcctgctcgcgatcgcc
ggaatcggtttcggcgtgcggcagcaggcaacgtcgctcgcgcgcacgcagcatgcgacg
attcaggccgcgtacctgtccagcaaggaagtcgaactgaggcattacgtcgagctcgcg
acgagcgcgatcatgccgctgtacgacgcgagcggccgcaacgcgcgcgacgacgcattg
ctgcgcacgcaggcgctcgcgatgctgcagaagatggatttcggccccgacggctatttc
ttcgtgtacgacctgcacggcaatgcgctgatgcatccgcgcgagcccgagcgcgtcggt
cacaactactggtcgatgcgcgacccgcagggcgcgctgacgatccagcagctgatcggc
gccgcgtcacgcggcggcggctacgtgcgctacacgtggcaacggccgtcgaccggcaag
gccgcgccgaagctcggctacgtcgtcgcgctcgagcgctggggctggatggtcggcacc
ggcatctatctcgacgacgtcgacaccgcgctgcaacgcatcgacgcgcgcgcgtccgcg
aacatcgagcggacgatgagctggctcaccgcgatcgcgctgaccggcgcggcggtgatc
gccgtctgcgcgctggtgctgaacgtcagcgagtcgcgcagcgccgacgcgaagctcaag
cagctcgcgcagcgtgtcgtcgaatcgcaggagcaggagcgcgcgcggctgtcgcgcgaa
ctgcatgacgggatcagccagatgatggtgtccgcgaagctgatgctcgaatccgcgctc
gcgcgcttcgagcgcggcgcgacgcggatgacggaagccgagcaggcgctcgcgtcgggc
atcggacggctcggcgacacgctgcgcgaagtgcgacgcatctcgcatgcgctgcgcccg
gcgatgctcgacgatctcggcctcgcggccgcgctcgaacagctcgtgcgcgagctcggc
gccgaaagcggcatcgacatcggctacacgcaggtggcacacagcggcgcgcggccgttg
cccgcgcccgtcaacacggcgctgttccggatcgcgcaggaagcactcagcaacatcgtg
catcatgcgcaagcgtcgcgcgcggccgtcacgctcgacgtcggcgcgcattccgtcacg
ctgaccatcgccgacaacggctgcggtttcgatgccgagcggtcgcagaccgatgcgcgc
cgcggcatcggcctgcgcaacatgcgcgagcgcctcgacgcgctcggcggcacattgacg
atcacgtcgcaggtcggccacaccgtcgtggccgcgcgcgtgccgctgcgcgccgcctga

DBGET integrated database retrieval system