KEGG   Burkholderia diffusa: WI26_26685
Entry
WI26_26685        CDS       T04698                                 

Definition
(GenBank) type VI secretion system protein ImpK
  KO
K11892  type VI secretion system protein ImpK
Organism
bdf  Burkholderia diffusa
Pathway
bdf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    WI26_26685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bdf02044]
    WI26_26685
Secretion system [BR:bdf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WI26_26685
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AOI61102
UniProt: A0A1B4C2I8
LinkDB
Position
2:complement(2590520..2591443)
AA seq 307 aa
MTQSANAPKILSARRAFTPPRRPNGTFLSRKNTGQRSSSRRSRPLGPLSPPEDEQARLAA
VLGHRNTLLEASRVLLRALVDIPALIDIGHDERLRDLIMDEVRAFERLCVRANIREEHMI
GARYCLCTALDEAAMRVLAARGDTSGSVAWAAGALTQRIGEDNQGGSKIYALSLRLLQDD
ANRWPLLEVIYRIFSLGFEGRYLRGRTFGAHDRVRERIYNAIAVHLPPVPDALSPHAQFA
ETTQQVSHFEIPVWMSVVLLSVMLCAFYAFCRIELGTQADSVRQQLSDITRVAPRNAIDP
PAAGPAQ
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacccaatccgctaacgcgcccaaaatcctgtcggcccgacgtgcgttcacaccacct
cgacgacccaacggcacctttctctcccgcaagaacacggggcagcgatccagttcgcgc
cgtagccgtccattggggccgctttcgccgccggaagacgagcaggcgagactggctgcg
gtacttggccatcgtaataccttgctcgaggcaagcagagtacttcttcgagcgttggtg
gatatccctgcgttaatcgacatcggccatgacgaacgcttacgcgacctgataatggac
gaggttcgcgcgttcgagcgcctatgtgtgcgggctaacattcgcgaagaacacatgatt
ggcgcacgatattgcctgtgtacggcgctggacgaagctgcgatgcgcgtactcgcggcg
cgaggcgacacgtcggggagtgtcgcatgggctgccggagcgctgactcagcgtatcgga
gaagacaaccagggcggttcgaagatatatgcgctgtcactgcgcttgttgcaagacgac
gccaaccgctggccgttgctcgaagtgatctacaggattttcagcctggggtttgaaggt
cggtatctgcgtggcaggacgttcggcgcgcacgaccgtgtacgagagcgaatttacaac
gcgattgccgtacatctcccacctgtcccggacgcgctttcgccccacgcgcaatttgcc
gaaacgactcagcaggtttcccatttcgaaattccggtatggatgtcggtggtgttgctg
tcagtgatgctctgcgcattctatgccttttgccgcatcgagttgggcacccaagcggat
agcgtgcggcaacaactctccgacattacgcgtgtcgcgccacgcaacgcgatcgatcca
ccggcggccggtccagctcagtag

DBGET integrated database retrieval system