KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_03850Help
Entry
GV66_03850        CDS       T03263                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Brite
Translation factors [BR:bdh03012]
 Eukaryotic Type
  Elongation factors
   GV66_03850 (tuf)
 Prokaryotic Type
   GV66_03850 (tuf)
Mitochondrial biogenesis [BR:bdh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GV66_03850 (tuf)
Exosome [BR:bdh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GV66_03850 (tuf)
  Exosomal proteins of breast cancer cells
   GV66_03850 (tuf)
  Exosomal proteins of colorectal cancer cells
   GV66_03850 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AII66907
UniProt: A0A076J1Z5
LinkDB All DBs
Position
complement(1064753..1065937)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVCAATDGPMPQTREHI
LLARQVNVPRLVVFLNKCDMVDDEEMLELVEMEMRELLSFYDFDGDNTPIIRGSALGALN
GVPQWEEKVMELMDAVDTWIPLPPRDIDKPFLMPVEDVFSITGRGTVATGRIEAGVIHVG
DEVEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKNEIKRGMILCKPGQVK
AHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVTIT
VELIYPVALNVGLRFAIREGGRTVGAGQITELLD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaatttgaacgttcgaaaccgcacgttaacattggtactatcggtcac
gttgaccacggtaaaaccactttgactgctgctatcactactgtgttggctaaaaaaggt
ctttcagaattgcgttctttcgattctatcgacaacgctcctgaagaaaaagaaagaggt
attactatcaatacttctcacgtagaatatcaaactgcaaatcgtcactatgctcacgtt
gactgtccgggtcacgccgactatgtgaaaaacatggttacgggtgctgctcagatggat
ggtgcaattattgtttgtgctgcaactgatggcccgatgcctcaaactcgtgagcatatc
ctgttggctcgtcaggtaaatgtacctcgtttggtcgttttcttgaataagtgtgatatg
gttgatgacgaggaaatgttggaattggtggagatggaaatgcgtgaattgctttcattc
tatgatttcgatggcgataatactcctatcattcgcggttctgcattaggtgctttgaat
ggtgttcctcaatgggaagagaaagtaatggaattgatggatgcagttgatacgtggatt
ccattgcctccgcgtgatattgataaacctttcttgatgcctgttgaagacgtgttctct
attactggtcgtggtactgttgctacaggtcgtatcgaagctggtgttatccatgtaggt
gacgaagttgaaatccttggtttgggtgaagataagaaatctgttgttactggtgttgaa
atgttccgtaaattgttggatcaaggtgaagctggtgataatgttggtttgttgttgcgt
ggtatcgacaaaaacgaaatcaaacgcggtatgattttgtgtaagccgggtcaggttaag
gctcactctaagtttaaagctgaggtttatatcttgaagaaagaagaaggtggccgtcat
actccgttccacaataaataccgtcctcagttctacttgcgtacaatggactgtacaggt
gaaatcactttgccggaaggaactgaaatggtaatgcctggtgataacgtaactattaca
gttgagttgatttacccggttgcattgaatgtaggtttgcgtttcgctatccgcgaaggt
ggacgtactgtaggtgctggacagataacagaacttcttgactaa

DBGET integrated database retrieval system