KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_04030Help
Entry
GV66_04030        CDS       T03263                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GV66_04030
Enzymes [BR:bdh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GV66_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 Thi4 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 NAD_binding_8 FAD_binding_3 Lycopene_cycl K_oxygenase Glutaredoxin DSBA Nitr_red_bet_C
Motif
Other DBs
NCBI-ProteinID: AII66935
UniProt: A0A0K2HGC4
LinkDB All DBs
Position
complement(1114020..1115570)
Genome map
AA seq 516 aa AA seqDB search
MLDSAIKDQLKGLFAQLEAHYTFDIFVHPQHESRAELVDLLEEVASCSDKLSCRLQDSEG
LKFILLKEGEDTGIIFRAVPGGHEFTSLLMAVLNADGKGKNFPDEFITRRIKALRGPISL
TTYLSLTCTNCPDVVQALNMMVLLNGQIRHEAVDGSINEEEVERMKVQAVPTVFADGEQI
HVGRSSMGDLLEKLEARYGSVELEAVETKEYDVLVAGAGPAGATAAIYSARKGLKVAIIA
ERIGGQVNETMGIENLISVPQTTGKQLAQDLKKHLAEYHIDILENRRIEKVEVTEGMKVL
SVKGGETYKAPVLIIATGANWRKLNVPGEEKYIGHGVAFCPHCDGPFYKDKEVAVIGGGN
SGVEAAIDLAGICSKVTVFEFMDTLKADTVLQEKAKSLPNVDIITNTQTVEVLGNGDKVV
GLIKKDRSSEKEEIFALDGIFVQIGLTANSALFKELLETNRMGEILTDKNGRTSVKGIYA
AGDVTDVSYKQIVIAMGEGAKAALVAFEDRMRGTIY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagatagtgcgataaaagatcagttaaaaggtctttttgcccaattggaagcgcac
tatacttttgacatcttcgtccaccctcagcacgaaagtcgtgccgagttggtggacttg
ttggaagaagtggcttcctgttcggataaactttcctgtcggttgcaggatagtgaaggg
ctgaagtttatccttttaaaagagggagaggatacgggaatcatattccgtgccgtacct
ggtggccatgaatttacttctttgttaatggctgttctgaatgctgacggcaaaggaaag
aattttccggacgagtttattaccagacgtatcaaggcgttacggggaccgattagtttg
accacctatttgtctctgacctgtaccaattgtcccgatgtggttcaagctttgaatatg
atggtacttctgaatggtcagatacgccatgaggcagtagatggatctataaatgaagaa
gaagtggaacggatgaaagtacaggctgttcctactgtatttgctgatggtgaacagatt
catgtggggcgtagcagtatgggggatctgttggagaagctggaagcccgttacggttcg
gtggaattggaagctgttgagacaaaagaatatgatgtactagtagccggtgctggtcct
gctggtgcgacagctgctatctactcagctcgtaaagggttgaaagtagcaataatagcc
gagcgtattggtggacaagtcaatgagacaatggggattgagaacttgatatctgtgcct
cagactaccggtaaacagttggctcaggatctgaaaaaacatttggcggaatatcatatt
gatattttagaaaatcgccggatagagaaagtggaagtgacagagggcatgaaagtgttg
tctgtgaaaggtggagaaacgtacaaggctcccgtattgatcattgctaccggggcgaat
tggagaaaattgaatgttcccggtgaagaaaaatacatcggtcatggagttgctttctgt
cctcattgtgacggaccattttataaagataaggaagtagcagtcataggtggtggaaac
tctggggttgaagctgctattgatttggcgggaatctgttccaaagtgactgtattcgag
ttcatggatactttgaaagcggatactgttttgcaggagaaagctaaaagcctgcccaat
gtggatattattactaatactcaaacggtagaggtgttaggaaacggtgataaagtggtg
gggcttataaagaaagaccgttcatccgaaaaagaagagatatttgccttggatggtatt
tttgtccaaattggtttgactgccaatagcgctttgtttaaagaattgctggaaacgaac
cgcatgggtgaaattctgactgataaaaatggacggacctctgtaaaaggtatctatgct
gccggagatgtaacggatgtttcttataaacagatagttatagcaatgggggaaggcgcc
aaggctgctttagttgcattcgaagaccggatgcgcggaacgatttattag

DBGET integrated database retrieval system