KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_04495Help
Entry
GV66_04495        CDS       T03263                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Pathway
bdh00500  Starch and sucrose metabolism
bdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GV66_04495
Enzymes [BR:bdh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     GV66_04495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AII67018
UniProt: A0A0K2HFR2
LinkDB All DBs
Position
1237615..1239831
Genome map
AA seq 738 aa AA seqDB search
MKLKKNLSLIAFLCISFIANAQQKLSSPDGNLEMTFTLDGQGTPTYELTYKQKEVIKPSR
LGLELKKEDANAKTDFEWTDKKDIDKLDIKTNLYNGFELKDVQTSTNDETWQPVWGEEKE
IRNHYNELAVTLNQPANDRFIIIRFRLFNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAG
DHTAYWIPGDYDTQEYDYTVSRLSEIRGLFSKAYTENSSQTAFSPTGVQTALMMKTDDGL
YINLHEAALIDYACMHLNLDDKNMIFESWLTPDAQGDKGYMQTPCTSPWRTVIVSDDARN
ILASRITLNLNEPCKIADTSWIKPVKYIGVWWDMITGKGSWAYTDDLSSVKLGETDYNKT
KPNGKHSANTANVKRYIDFAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFNV
KELQSYAASKGVKLMMHHETSASVRNYERHMDQAYQFMADNGYNSVKSGYVGNIIPRGEH
HYGQWMDNHYLYAVKKAADYKIMVNAHEAVRPTGICRTYPNLIGNESARGTEYESFGGNN
VNHTTILPFTRLIGGPMDYTPGIFETRCNKMNPTNNSQVRSTLARQLALYVTMYSPLQMA
ADIPENYERFMDAFQFIKDVAIDWDETKYLEAEPGDYITIARKAKGTNDWYIGCTADENG
HSSKLIFDFLDPDKKYIATVYADAKDADWKDNPQAYTIRKGIVTNKSKLNLHAASGGGYA
ISIKEVKDKSELKGIKRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaagaatctttcacttatcgcatttctctgtatctcattcattgcgaat
gcacaacagaaactgagctctccggatggcaatctggagatgacatttaccctagatggt
cagggcactcctacatatgaactgacctataaacagaaggaagttatcaaacccagtaga
ttgggattggaattaaagaaggaagacgcaaacgccaaaaccgacttcgaatggactgat
aaaaaagacatagacaaactggacatcaagacaaacctttataacggtttcgagctaaag
gatgtccagacatctaccaacgatgaaacatggcaaccggtatggggagaagaaaaggaa
atccgtaaccattataatgaattggcggtcacattgaaccagcctgccaatgacagattt
ataatcatccgtttccgcctattcaacgacggtctgggtttccgctatgaatttccgcag
cagaagaacttaaactatttcgtgatcaaagaagaacattcacaatttgccatggcaggt
gaccacactgcttactggattccgggagattacgatacacaggaatatgactataccgtt
tcccgcctgtcggaaatcagaggattgttttcaaaggcttatacggagaactcctcgcaa
acagcattcagccccaccggtgtacaaactgccctgatgatgaaaacagacgatggtctg
tacatcaatctgcacgaagctgctttgatagactatgcctgcatgcacctcaatctggat
gacaagaacatgattttcgaatcatggctgactccggacgcacaaggtgacaaaggatat
atgcagactccctgcacttcaccatggcgtaccgtcatcgttagtgatgatgcccgcaac
attcttgcctcacgcattacgttaaacctgaacgaaccttgcaaaatagcagacacttcc
tggatcaagcctgtgaaatacatcggcgtgtggtgggatatgattacgggaaaaggctca
tgggcttacacagatgacttatccagtgtaaaactaggtgaaacagattacaacaaaaca
aaacctaacggcaaacactctgccaacaccgccaacgtaaaacgttacattgattttgca
gcggagcatggattcgaccaagtattggtagaaggctggaacgaaggttgggaagactgg
ttcggaaaaagcaaagattatgtttttgattttgtaactccctatcccgactttaatgtt
aaagaacttcaaagttacgctgcaagcaaaggtgtaaaactgatgatgcatcatgaaact
tcggcttctgtacgtaactatgaacgccacatggaccaggcataccaattcatggcagac
aacggatataattctgtaaaaagtggctatgtaggcaacattattccacgtggtgagcac
cactatggacaatggatggataaccattatctatatgcggtgaaaaaagcagcggactac
aaaatcatggtaaacgcccacgaagctgtacgccctaccggaatatgccgcacctatccc
aacctgatcggtaacgaatcagcacgcggaactgaatatgagtcatttggcggtaacaac
gtaaaccatactaccatcttgcctttcacacgattaataggtggtccgatggactacact
ccgggtatctttgaaacccgttgtaacaaaatgaatcctaccaacaattcacaggtacgt
tctactttggcacgtcaactggccctgtatgtaacaatgtacagcccattacaaatggct
gctgacatacctgaaaactatgaacgcttcatggatgccttccaattcataaaagatgta
gccattgactgggatgaaaccaaatatctggaagccgaaccgggagactatattaccatt
gcccgcaaagctaaaggaaccaacgactggtatatcggctgtacggcagatgagaacggt
cattcttcaaaactgatatttgatttccttgatccggacaaaaaatacatcgcaactgta
tatgcagacgcaaaagatgccgactggaaagataatccgcaggcatataccatccgtaaa
ggcattgtgaccaacaaaagcaaactgaacttacacgcagcaagcggtggtggttatgca
atcagcattaaagaggtaaaagataaatcagaattaaaaggtattaagaggttatag

DBGET integrated database retrieval system