KEGG   Bacteroides dorei HS1_L_3_B_079: GV66_08950Help
Entry
GV66_08950        CDS       T03263                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bdh  Bacteroides dorei HS1_L_3_B_079
Pathway
bdh00473  D-Alanine metabolism
bdh01100  Metabolic pathways
bdh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GV66_08950
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GV66_08950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdh01011]
    GV66_08950
Enzymes [BR:bdh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GV66_08950
Peptidoglycan biosynthesis and degradation proteins [BR:bdh01011]
 Precursor biosynthesis
  Racemase
   GV66_08950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AII67814
UniProt: A0A0K2HHR6
LinkDB All DBs
Position
2255815..2258280
Genome map
AA seq 821 aa AA seqDB search
MSSSIENIEKVLGAKRFGNRSAQIDWILTDSRSLCFPEETLFFALKTKRNDGHKYLSELY
ERGVRSFVVGELPADMQSFQDANFLQLTNPLKGLQKLAEKHREQFQIPVIGITGSNGKTI
VKEWLYQLLSPDRVVTRSPRSYNSQIGVPLSVWLMNEHTELAIFEAGISEMGEMEALQTI
IKPTVGILTNIGGAHQENFFSLQDKCMEKLTLFKDCDVIVYDGDNELISSCVAKSLFASR
EIAWSKKDNERPLFIESIQKGEHATTIKYRYLGMPNEFSIPFIDDASIENSLHCLAVALY
MMVPPEQITERMARLEQIAMRLEVKEGKNGCVLINDSYNSDLASLDIALDFMSRRSDDKG
KKRTLILSDMLETGQSSKLLYRQVAELVHSRGVEKIVGVGEEIRTAAARFEIEKYFFRTT
EELLESDLLAGLRNEVILVKGSRAFHFDRISDRLELKVHETILEINLNALVDNLNYYRSK
LKPETKMVCMVKASAYGAGSYEIAKTLQDHRVDYLAVAVADEGSDLRKAGITCSIMIMNP
ELTAFKTMFDYKLEPEVYSFHLLNELIKAAEKEGVTNFPIHIKLDTGMHRLGFAPEEIPE
LIDRLKKQTAVIPRSVFSHLVGSDGAQFDSFTRRQIEMFEAASECLQEAFQHKILRHICN
TAGIERYPGAQFDMVRLGIGLYGIDPFTNQIINNVSTLKTTILQIHEVPKEETVGYSRKG
HLERDSRIAAIPIGYADGLNRRLGNGHAYCLVNGQKASYVGNICMDVCMIDVTDIDCKEG
DKAIIFGDDLPVTVLSEILETIPYEILTSVSNRVKRVYYQN
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcgattgaaaatatagaaaaagttctgggagcaaagcggtttggaaaccgt
agtgcacagattgattggattttaactgatagccgttcattgtgttttccggaagaaaca
ttattttttgctttaaaaaccaaacggaatgacgggcataaatatctttcggaattgtat
gaacgtggagtccgtagctttgtagtgggtgaattgccggctgatatgcaatcttttcaa
gatgcgaatttcctgcagttgaccaatcctctgaaaggattacagaaattggcggaaaaa
catcgggagcagtttcagattccggttataggaattacgggaagtaatggaaaaaccatt
gtgaaggaatggttatatcaattgcttagtccagatcgtgtggtaacccgttcgccacgt
agctataactcacagataggtgtgccactttcggtgtggttgatgaatgagcacactgag
ttggctatttttgaagcgggtatttccgaaatgggtgaaatggaggcgttgcagactatc
attaaacctactgtgggtattttgactaatattggtggtgcgcatcaagagaattttttc
tctttacaggataaatgtatggagaaacttactttgttcaaagactgtgacgttattgtt
tatgatggcgataacgaattgataagttcgtgtgtggcaaaatctctttttgcctcgcgt
gagattgcttggtcgaaaaaggacaatgaacgtccgttgtttattgagtccattcaaaaa
ggagaacatgctaccactattaaataccgttatctggggatgccgaatgaatttagtatt
ccttttatagatgacgcttctattgagaattcgttgcattgtctggctgtggctttgtat
atgatggttccccctgaacaaataaccgagcgcatggcgcgtttggaacagattgctatg
cgtctggaggtaaaagaaggcaagaatggctgtgtgttgatcaatgatagttataattca
gatttggcttctttggatattgctcttgactttatgtcgcgtcgttctgatgataaaggg
aaaaaacggacacttatcctctcggatatgcttgaaacaggacagagcagcaaactactt
tatcgtcaggttgccgaattggtacatagccggggagtagagaagattgtcggggtagga
gaggaaattcggactgctgctgcccgttttgagatagaaaagtatttttttcgtactaca
gaagaattattggaatcggatttgctggccgggctgcgtaatgaggtgattttggtaaaa
ggttcgcgtgcttttcattttgaccggatttcagatcgtttggaactgaaagtgcatgaa
accattttggagatcaatttgaatgctttggttgataacttgaattattatcgcagcaaa
ctgaaaccggaaacaaaaatggtatgtatggtgaaggcttctgcatacggtgccggttca
tacgagatagctaaaacactgcaagatcaccgtgtggattacttggcggtagctgtggct
gatgaaggttcggatttgcggaaagcgggaatcacctgttccattatgattatgaatcct
gagttgacagcattcaagaccatgtttgattataaattggaacccgaggtttacagtttt
catttattgaatgaactgattaaagctgctgagaaagaaggcgtaacgaatttccccatt
catattaaattggatacggggatgcaccgtttgggttttgcacccgaagagattccagaa
ctgatagaccgtctgaagaagcagacagctgttattccacgttctgtattctctcatttg
gtaggcagtgacggggctcagtttgattcgtttacgcgcagacagatagaaatgtttgaa
gctgcttctgaatgtttgcaggaggcttttcagcataagatattgcgtcatatctgtaat
acagccgggatagaacgctatccgggtgctcagttcgatatggtgcgtttgggaatcggt
ctttatggaattgatccgtttaccaatcagattatcaataatgtaagtacattaaaaacc
actattcttcagattcatgaggttcctaaggaagaaacagtggggtatagtcgtaaagga
catttggaaagggattcccgtattgccgctattcctatcggctatgccgacggactgaac
cgacgtttgggaaatggacatgcctattgtttggtgaatgggcagaaagcgtcatacgtg
ggtaatatctgtatggatgtgtgcatgattgatgtgacggatattgattgtaaggaaggg
gataaagctatcatcttcggagatgatttaccggtcactgttctgtcagagattctggaa
actattccatacgagatcttgaccagtgtgtctaatagggtaaaacgagtttattaccag
aattaa

DBGET integrated database retrieval system