KEGG   Brachypodium distachyon: 100822109Help
Entry
100822109         CDS       T01717                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100822109
   00500 Starch and sucrose metabolism
    100822109
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100822109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100822109
NCBI-ProteinID: XP_003566018
UniProt: A0A0Q3G1J1
LinkDB All DBs
Position
2
AA seq 882 aa AA seqDB search
MANASYLGLLLLFFRLVAVPWGAAGYEVASVTRSGTLLSARLELAGGTAAPSSLGPDVRS
LLLTASLETDSWLHVRITDANHPRWEVPQDVIPRPTPEDVLLQLRGRSALPRTSRRVLST
AGSDIDFTIYASPFRFMVSRRSTGDVLFDTSSNLIFKDRYLELTSALPEGRASLYGLGEH
TKRTFRLLHNETFTLWNSDIQAGNANVNLYGSHPFYMDVRLPPLGAGSGVDATHGVLLLN
SNGMDVLYGGSYITYKIIGGVLDYYFFAGPSPLDVVDQYTQLIGRPVPMPYWSFGFHQCR
FGYKNVADLEGVVDGYAKARIPLEVMWTDIDYMDKFKDFTLDPVNFPASRLRPFVDRLHR
NGLKYVLILEPGISVNTTYGTFIRGMQHDIFLKRNGREYLGKVWPGEAYFLDFMNPRAAE
FWAHEIALFRRTVPIDGLWLDMNEISNFITPTPLNALDDPPYRINNNGERRPINNKTVPA
SAMHHGGVSEYDAHNLFGLLQSRATHRALIADTGRRPFVLSRSTFVGSGRYAAHWTGDNL
ATWDDLRYSINTMLSFGLFGVPMVGADICGFGGEPTEELCSRWIQLGALYPFSRQHSAIS
KVPRELYLRESLARSARKALGLRYRLLPYIYTLMYEAHTSGAPIARPLLFSYPHDIETYD
IDKQFLLGRGVLVSPVLEPGATAVDAYFPAGRWFSLYDYSLAVAAMGPGRRVMLPAPSDT
VNVHVAGGNILPLQQSLLTTACARRSVFHLLVALADDGTANGDLFLDDGESPEMGERGSE
FSLIKFSCSTGSNGVIRVRSRVVHNSYAPSRTLVIGKVVLMGLPSLAPQEKLAVYVNGTV
VNGNPTRYLNRGGLGVAHVRGLSLVVGEEFELKVATSPLVYY
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgctagttacctcggcctcctcctccttttcttccggcttgtcgccgtgcct
tggggcgcggcggggtacgaagtggcgtcggtcacgcggtcggggacgctgctgtcggcg
cggctggagctcgccggcgggacggcggcaccgtcgtcgctcgggcccgacgtccggagt
ctcctcctcactgccagcctcgagacggacagctggcttcacgtccgcatcacggatgcc
aatcatccccgatgggaggtgccccaagacgtcatccctcgccctacaccggaggacgtc
cttctccagctccgggggaggtccgccttgccgcgtactagccgtcgcgtcctctctacc
gcgggttctgacatcgacttcaccatctacgcctccccgtttcgcttcatggtttcccgc
cgctccaccggcgacgtgctgttcgacacttcctcgaacctcatcttcaaggaccggtac
ttagagctgacgtcggcgctgccagaagggcgggcatccctgtacgggttgggggagcac
acgaagcgcacgtttcggctgctgcacaacgaaactttcactctctggaactcggacatc
caggcggggaacgccaacgtgaacctctacggctcgcacccgttttacatggacgtgagg
ttgccgccgcttggtgccggatccggcgtggatgcgacgcacggcgtgctcctcctcaac
agcaacggcatggacgtcctgtacggcgggtcatacatcacctacaaaatcatcggcggt
gtactcgattactacttcttcgccgggccttccccgctggacgtcgtcgaccaatacacc
cagctcattggccgccctgtccccatgccctactggtcattcgggttccaccagtgtcgg
tttgggtacaagaacgtggctgacttggagggtgtggtcgacggctatgccaaggccagg
atcccactggaggtgatgtggacagacatcgattacatggacaagttcaaagacttcaca
ttggatccggtcaacttcccggccagccgactccggcctttcgtcgaccggcttcaccgg
aacggcctcaaatacgtcctcatcctagagcccgggattagtgtcaacacgacatatgga
acgttcatccgcgggatgcagcatgacatcttcctgaagcgtaacggcagggagtacctt
ggcaaggtgtggcctggcgaggcgtatttcctggacttcatgaacccacgcgccgccgag
ttctgggcgcatgagatcgccctcttccggcgaaccgtcccgatcgacgggctgtggcta
gacatgaacgagatctccaacttcatcactccgacgccgctcaacgctctggacgacccg
ccctaccgcatcaacaacaacggcgagcgccgtcccatcaacaacaagacggtgccagca
tccgcgatgcaccacggcggcgtgtccgagtacgacgcgcacaacctcttcggcctcctc
cagtctcgcgccactcaccgcgccttgatcgctgacacaggccgccggcccttcgtgctc
agccgctccacgttcgtcgggtccggccggtacgccgcgcactggaccggtgacaacctc
gcgacgtgggacgacctccgctactccatcaacaccatgctcagcttcggcctcttcggg
gtccccatggtcggcgccgatatctgcggcttcggcggcgaacctacggaggagctctgc
agccggtggattcagctcggtgctctgtacccattctccaggcaacactctgcgatcagt
aaagtcccgcgggagctctacctccgggagtcattggcgcggtcggcgagaaaggcgctc
gggctgcggtacaggctgctcccctacatctacaccctcatgtacgaggcgcatacgtct
ggggcgcccattgcccgcccgctcttattctcctacccacacgacatcgagacctacgac
attgacaagcagttcctgctcggccgcggcgtgctcgtctcgccggtgctcgagccggga
gcgaccgccgtcgacgcctacttccctgctggccggtggttcagcctctacgattattcc
ctcgccgtcgccgccatggggcccgggaggcgtgtgatgctcccggcgccctcggacacg
gtgaacgtgcacgtggccggcgggaacatcctgccgctgcagcagagcttgctgacaaca
gcgtgcgcgcgtcggagcgtgttccacctcctggtcgcgctcgcggatgacggcacggcc
aacggggacctgttcctggacgatggcgagtcgccggagatgggcgagaggggaagcgaa
ttcagcctcataaagttcagctgctcgacggggagcaacggcgtgataagagtgaggtcg
cgtgtggtgcacaactcgtacgcaccgagccggacgctggtcatcggcaaggtggtgctc
atggggctcccgtcgctggcgccgcaagagaagctcgccgtctatgtcaacggaacagtg
gtgaatgggaaccccacgcggtacctgaacagaggagggctcggcgtcgcgcacgtccgc
gggctgtcgctggtcgtcggagaggagttcgagcttaaggtggccacttccccattagtc
tactactag

DBGET integrated database retrieval system