KEGG   Brachypodium distachyon: 100822352Help
Entry
100822352         CDS       T01717                                 

Definition
(RefSeq) uncharacterized protein LOC100822352
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH
Motif
Other DBs
NCBI-GeneID: 100822352
NCBI-ProteinID: XP_003574667
UniProt: I1I815
LinkDB All DBs
Position
3
AA seq 333 aa AA seqDB search
MGWKGILGFDYGVVQAPLGPDISGPELAAAVANAGGIGLLRLPDWPAPDHVRELIRRTRS
LTERPFGAAIVLPFPHEENLRVVLEEKLAVLQVYWGEFPKERVDEAHRAGVKVLHQVGTL
EEAEKAKEAGVDGIIVQGHEAGGHVIGQEGLLPLLPRVVDLFSDSTILVIAAGGIVDGRG
YAAALALGAHGVCLGTRFVATEESFAHPQYKKRLTEMSCTDYTNVFGRARWPGAPQRVLK
TPFYVEWKNLPDHETEENQPIIGHSIIHGVHKDVRRFAGTVPNATTTGDINSMAMYAGQG
VGLITEIVPAGEIVKRLVAEAQHVTGENLSVFP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggggtggaagggcatcctgggcttcgactacggcgtggtccaggcgccgctcggcccc
gacatctccggcccggagctcgccgccgccgtcgccaacgccggcggcataggcctcctc
cgcctccccgactggccggcgccggatcacgtgagggagctgatacggaggacgaggagc
ctgaccgagcggccgttcggggcggccatcgtgctgcccttcccgcacgaggagaacctg
agggttgtgctggaagagaagctcgccgtgctgcaggtgtactggggcgagttccccaag
gagcgggtcgacgaggcccaccgcgccggcgtcaaggtcttgcatcaggtcggtaccctt
gaggaggcagagaaagctaaggaagctggtgtagatggaattattgttcaaggccatgaa
gcaggggggcatgtgattggtcaagagggtctcctaccgttgctgccaagagtagtggat
ctattttcggatagtactatcctggttatcgcggctggtggaattgtagatggtcgtggc
tatgctgcagcattggcacttggtgctcacggtgtttgcttaggaacaaggtttgtggct
actgaggaaagctttgcacatcctcagtataagaaaaggctaacagagatgagctgtacg
gactatacaaatgtattcgggcgagctagatggcctggtgctccacaacgtgtcctgaaa
acacccttctatgttgagtggaagaatctcccagatcatgaaacagaggaaaatcagcct
attataggccactctatcatccatggtgtgcacaaggatgtacgtcggtttgctggtact
gtccctaatgcaacaacaacaggcgatatcaatagcatggccatgtatgctggccagggt
gttgggctaatcacggagatcgtaccagcaggtgaaattgtcaaaaggctagttgctgaa
gcacagcatgtcaccggagaaaatctttccgtttttccctga

DBGET integrated database retrieval system