KEGG   Brachypodium distachyon: 100822395Help
Entry
100822395         CDS       T01717                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bdi03009]
    100822395
Enzymes [BR:bdi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100822395
Ribosome biogenesis [BR:bdi03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    100822395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 100822395
NCBI-ProteinID: XP_003579819
UniProt: I1IY26
LinkDB All DBs
Position
5
AA seq 494 aa AA seqDB search
MSFWGAEVKPEKPYTHTHSPRRGRLRVTQATIGGEASKAERGAKVRLQCTVKNRDPLLLC
TLLPGQSETLNLDLEFEEKYVTFSVLGPMSVHLTGYYIGNEYDEDIGDSDTGSDSDDGFL
VSDDDDGDMVIPASHDSEDGDSEYDSDYDSETGDEDLMYNQRRGKSSVVIEEIQEDDKPA
SGEGLKGSNKKQNSKNGDDSRLQLAVRAPPAESLESEDEDGFPVSESKKSSKGSSKKGTN
LNNVPNEDRKRKSGAISDHRDSSGEVDAENDGVSKKKKKAKDKKTAVDSEKLNSDEKEIK
QDSSANIVEAKQKKKKSKDASASEADADQQVKMIISDNNAEEVTKQGAKKKNKEKKTKEN
NTNEIQADTNLTKPDDKEQASQTRTFGNGMIVQTVALGKPDGKKASPGKKVSVKYIGKLK
NGTIFDSTVGKRPFEFRLGVGQVIKGWDIGVNGMRIGDKRKITIPPSMGYGNQKIGAIPP
NSTLVFDVELVNVK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttggggcgccgaagtgaagcctgagaagccctacacgcacacccacagcccc
cgccgcggccgcctgcgcgtcacccaggcgactatagggggcgaggccagtaaggcggag
agaggggcaaaggtgcgtctgcaatgcaccgttaagaacagggaccctctgttgctctgc
accctgctcccagggcagtcggagacactcaacctggacctcgagttcgaggagaagtac
gtgactttctcggtgcttggaccaatgagcgttcacctcactggatactatattggtaat
gagtacgatgaggacataggtgacagtgatactggtagtgattccgatgatggtttcttg
gtatctgatgatgatgatggtgatatggtcattccagcatcccatgacagtgaagatggc
gattcagaatacgattcagactatgattcagagactggtgatgaggacttgatgtacaat
cagcgtagaggcaagagctcagttgtcattgaggagattcaagaggatgacaagcctgct
agtggcgaaggactgaagggttcaaacaagaaacagaacagcaaaaatggtgatgattct
cgacttcagcttgctgttagggcaccacctgctgaatccctggaaagtgaagatgaagat
ggctttcctgtatctgaatcaaagaagagttctaagggtagttcgaagaaaggtactaat
ctaaataatgtgccgaatgaagataggaaaaggaaaagtggcgccataagtgatcatcgt
gactcatcaggggaagttgatgctgaaaatgatggggtgtcaaagaagaagaaaaaggcc
aaggacaaaaagactgccgtggacagtgaaaagttaaacagtgatgaaaaggagatcaaa
caggattcctcagctaacattgttgaagccaaacagaagaaaaagaaaagcaaggacgca
agtgcttctgaagctgacgctgatcagcaagttaaaatgatcataagtgacaataatgcc
gaggaggttacaaaacagggagccaagaaaaagaacaaggagaagaaaacaaaggagaac
aatacaaatgaaatccaggcagacacgaatcttacaaagcctgatgacaaggagcaggca
tcccaaacacggacttttggcaatggtatgattgttcagaccgtggcgttgggcaaacca
gacggtaaaaaagcttcccctggaaaaaaggtttctgttaagtacattggcaagttgaag
aatggcacaatttttgactctactgttggaaagaggccttttgaattcagactgggtgtt
ggacaggttattaaaggctgggacattggtgtcaatggtatgcgaattggggataaaaga
aagatcaccattccaccatctatgggttatggaaatcagaagatcggggcaataccgcca
aactcaactcttgtgtttgatgttgagctggtgaatgtaaaatga

DBGET integrated database retrieval system