KEGG   Brachypodium distachyon: 100823502Help
Entry
100823502         CDS       T01717                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00020  Citrate cycle (TCA cycle)
bdi00190  Oxidative phosphorylation
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100823502
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100823502
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100823502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100823502
NCBI-ProteinID: XP_003557614
UniProt: I1H3W3
LinkDB All DBs
Position
1
AA seq 620 aa AA seqDB search
MWRSFVSRGLSKGKASASRLFSTTTSSSYTLVDHSYDAVVVGAGGAGLRAAIGLSEHGFN
TACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREA
PKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYG
QAMKHNTQFFVEYFALDLLMDNEGNCQGVIALNMEDGTLHRFRATNTILATGGYGRAYFS
ATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGER
FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISE
TAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVDIKGDNPDTVIHGLMAAGEAACA
SVHGANRLGANSLLDIVVFGRACANRVAEISRPGDKQKPLEKGAGEKTIAWLDKLRNANG
SLPTSKIRLNTQRIMQNNAAVFRTQETLEEGCQLISKAWESFHDVKISDRSLIWNSDLIE
TIELENLLINACITMYSAEARKESRGAHAREDFTTRDDERWMKHSMGYWENEKVRLAYRP
VHMNTLDDEIESFPPKARVY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcagcttcgtctcgcgcggcctgtccaagggcaaggcctccgcctccaggctc
ttctccacgacgacctcgtcgtcctacacgctggtggaccactcgtacgacgcggtggtg
gtgggcgccggcggcgcggggctccgggcggccatcgggctctccgagcacggcttcaac
accgcctgcatcaccaagctcttccccacgcgctcgcacaccgtcgcggcgcagggaggc
ataaatgctgctcttggaaacatgagcgaagatgactggaggtggcatatgtatgatact
gtcaagggaagcgattggcttggtgatcaagattctattcagtatatgtgcagagaagca
cccaaagctgtcatagaacttgaaaactatggactgccattttcgagaactgaagatggg
aagatataccaacgtgcctttggaggccagagcttagattttgggaaaggtggacaggcc
tacagatgtgcatgtgctgcagacagaacaggacatgctatgctacacacactatatggt
caagctatgaagcataacacccagttttttgtagaatattttgcactagaccttctgatg
gacaacgaaggcaactgccagggagtcattgccttaaacatggaagatggcacccttcac
cgctttcgtgctacaaatacaattctagctacaggaggttatggtagggcctacttctca
gcaacctcagctcacacatgtactggagatggcaatgctatggttgcacgtgctggttta
cctcttcaagatcttgagttcgtccagttccatcctacaggcatttatggtgctggatgc
ctcattactgaaggatcccgtggcgagggtggtatccttaggaacagtgaaggtgagcgt
ttcatggaacgatatgctcctactgcaaaggatcttgcttctcgtgatgttgtttcaaga
tcaatgacaatggaaattagagaaggacgtggtgttgggccactgaaggatcacatctat
ttgcatcttaaccatctgcctcctgaagttctcaaggaaaggcttcctggtatatctgaa
actgctgctattttcgccggtgttgacgtcaccaaggagcccattccagttttgcctact
gtgcactacaacatgggtgggatccctacaaattaccatggggaggttgtggatatcaag
ggtgataatccagatactgtaattcatggtttaatggctgctggagaagcagcgtgtgcg
tctgtccatggtgcaaatcgtctgggtgcaaattcacttcttgatatagttgtgtttggc
agagcttgtgcaaacagggtagctgagatttctagaccaggtgacaagcagaaacctctc
gaaaaaggtgcaggagaaaagactatagcatggttggacaagctgagaaatgcaaatggg
tcattgccaacttccaagatccgtctcaacacacaacgtattatgcaaaataatgctgct
gtgttccgtacacaagaaacgcttgaagaaggttgtcaactgattagcaaagcatgggaa
agttttcatgatgtgaagatcagtgatcgaagtctcatatggaattccgacttaatagag
accatagagctggaaaatctgttgataaatgcatgcataactatgtattcagcagaggct
cgcaaagaaagcagaggagctcacgctcgtgaagatttcacgacaagagacgatgagcgt
tggatgaagcactcaatggggtactgggagaacgagaaggtacgattggcatacaggccg
gtccatatgaacacgttggatgacgaaatcgagtcgttcccaccaaaagcacgagtctat
tga

DBGET integrated database retrieval system