KEGG   Brachypodium distachyon: 100824447Help
Entry
100824447         CDS       T01717                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100824447
   00500 Starch and sucrose metabolism
    100824447
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100824447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100824447
NCBI-ProteinID: XP_003560452
UniProt: A0A0Q3JH50
LinkDB All DBs
Position
1
AA seq 873 aa AA seqDB search
MAMAGSPSAAGSCHLPALLLFLAAVPWGVDCAGAGAGTYDVVSVTSSGSQLSAGLELAAA
GGVDPALGPDVQRLHLTASLETNTRLQVRITDADRPRWEIPQDILPRPTPEHVVPYKPLA
SPGSRVLSAPGSDLVFTLHSSPFRFTVARVSNGDVLFDSLPRLVFKDQYLELTTALPSER
ANLYGLGEQTKQSFRLRHGDTFTLWNADIAAATVDVNLYGSHPFYMDLRAGAAHGVLLLN
SNGMDVVYGGSSLTYKVIGGILDFYFFAGPTPLAVVDQYTDLVGRPAPMPYWSFGFHQCR
YGYENVNDLERVVAGYAEAKIPLEVMWTDIDYMDSFKDFTLNRVNFSAAELRPFVDRLHR
NAQKYVLILDPGISIIDPKYGTFIRGMEAGIFLKRNGTEFRGNVWPGDVYFPDFLNPRAA
EFWAREISLFRRTIPVDGLWIDMNEISNFFNPDPLTPLDEPPYSINNQGDRRTINYKTAA
ASATHYGGVSEFDAHNLFGLLESRATHAALLRDTGRRPFVLSRSTFVGSGRYTAHWTGDN
DATWGDLRYSINTMLSFGLFGMPMVGADICGFGKNTTEELCGRWIQLGAFYPFSRDHSAI
FTVRRELYLWDSVARSARKALGLRYRLLPYLYTLMYQAHVSGAPMARPLFFSFPDDAATY
GVDAQFMLGRAVLVSPVLQPGATSVEAYFPAGRWFSLFDHSSVVVSKVGKRVTLPAPADT
VNVHVAGGSIVPMQGHALTTARARRTAFRLLVALAEDGTAAGELFVDDGESPEMGGTRSK
FSLVRFTSSTGTDGVVRVRSQVVHDSYKPSRRMVIGKVVVMGIKRPAPMKKLSVRVNGAE
VKAASMEAGTGLGVAHVGGLSLVVGQPFELAIS
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgggctcgccgtccgcggccggcagttgtcacctgccggccttgctcctg
ttccttgccgccgtgccgtggggcgtggactgcgccggtgccggggcggggacgtacgac
gtcgtgtcggtcacctcgtcggggtcgcagctgtcggcggggctggagcttgccgccgcc
ggcggggtggacccggcgctcgggcccgacgtccagaggctccacctgactgccagcttg
gagacgaacacacggctgcaggtcagaatcacggacgccgatcgtcctcgatgggagatc
ccccaggacatcctcccccgccccacgccggagcacgtcgtcccctacaagccgctcgcc
tcgccgggcagccgcgtcctctccgcgcccggctccgacctggtcttcaccctccactcg
tcgcccttccgcttcaccgtcgcccgcgtctccaatggagacgtgctgttcgacagtttg
ccgcgactggtcttcaaggaccagtacctggagctcacgacggcgctgccaagcgagcgg
gccaatctctacggcctgggcgagcagacgaagcagtccttccggctgcggcacggcgac
accttcacgctgtggaacgccgacatcgccgcggccaccgtcgatgtcaacttgtacggg
tcccatccgttctacatggacctgcgcgctggcgccgcgcacggcgtgctgctgctgaac
agcaatggcatggacgtggtctacggcggctcgtccctcacctacaaggtcatcggcgga
atcctggacttttacttcttcgccggcccgacgccgctcgccgtcgtggaccagtatacc
gacctcgtcggccgccccgccccaatgccatactggtccttcggatttcaccaatgccgc
tatggctacgagaatgtgaatgacctggagcgggtggtggcggggtacgccgaggccaag
atcccgctcgaggtcatgtggaccgacatagactacatggacagtttcaaggatttcacg
ctcaaccgggtcaatttctccgccgccgagctccgccccttcgtcgaccgcctccaccgg
aacgcccagaaatacgtgctcatcctcgacccggggatcagcatcattgaccccaagtac
gggacattcatccggggtatggaggcgggcatcttcctcaagcggaacgggaccgagttc
agaggcaacgtgtggcccggggacgtctacttccccgatttcctcaacccgcgggcggcg
gagttctgggcgcgggagatctcgctgttccggcggaccatcccggtggacggcctgtgg
atcgacatgaacgagatttcaaacttcttcaacccggacccgctgaccccgttggacgag
ccgccgtacagcatcaacaaccaaggcgaccgccggacgatcaactacaagacggcggcg
gcgtcggcgacgcactacggcggggtctcggagttcgacgcccataacctgttcgggctg
ctcgagtcccgggccacgcacgcggcgctcctccgggacacgggccgccgccccttcgtc
ctcagccgctccaccttcgtcgggtccggccgctacaccgcgcactggaccggcgacaac
gatgccacctggggtgatctgaggtactcaatcaacacgatgttgagcttcggcttgttc
gggatgccaatggttggcgcagatatctgcgggttcgggaaaaacacgacggaggaactg
tgcgggcgctggatccaactcggggcattctaccctttctcgagggaccattcggcgatc
ttcaccgtccgccgggagctgtacctgtgggactcggtcgccaggtcggcgcggaaagcc
ctcggcctgcgctaccggctgctgccgtacctctacacgctgatgtaccaggcgcacgtc
tccggggcgccaatggcgaggcccctcttcttctccttccccgacgacgcggccacctac
ggcgtcgacgcgcagttcatgctcgggcgagccgtcctcgtgtcgccggtgctccagccg
ggcgctacgagtgtggaagcttatttcccggcggggcgctggttcagcctcttcgaccac
tcctccgtcgtcgtctccaaggtaggcaagcgcgtgacgctcccggcgcccgcggacacg
gtcaacgtccacgtggccggcgggagcatcgtgccgatgcaggggcacgctctgaccacg
gcgcgcgcgcgccggaccgcgttccggctcctcgtcgcgctcgcggaggacggcacggcg
gccggggagctgttcgtggacgacggcgagtcgccggagatgggcgggacgaggagcaag
ttcagcctcgtgaggttcacatcttcgacggggaccgatggcgtggtcagagtgcgctcg
caagtcgtgcacgactcgtacaagcccagccgcagaatggtcatcgggaaggtggtcgtc
atggggatcaagcggccggcgccgatgaagaagctctccgtgcgtgtcaatggcgcggag
gtgaaggcggcgagcatggaagccggcacagggctcggtgtcgcgcacgtcggcgggctc
tcgctcgtcgtcgggcagccgttcgagctcgccatctcgtaa

DBGET integrated database retrieval system