KEGG   Brachypodium distachyon: 100824574Help
Entry
100824574         CDS       T01717                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100824574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bdi03036]
    100824574
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100824574
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100824574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 100824574
NCBI-ProteinID: XP_003563196
UniProt: I1GUX1
LinkDB All DBs
Position
1
AA seq 678 aa AA seqDB search
MEVEESSPSSPLSSPSSSPSSDSIDLNFLPFLKREPKSEPASPEHDPLPPPPPPPPPPQA
AAAVAVAYVDPTPATPDLSSPAVMTPLQSLPPNPDEDALFAEYCRLASLYLLSAGAGAIV
QAPTPEAAAPAVVQPGSGSAVKKRRPRSSELVRVSSLGMRDQIYFRDVVRRARITFESLR
GLLLKDDERAEALGLPGVVGLGSTDRRRVRADLRAAALMADRDLWLNRDRRIVGPIPGIS
VGDAFFFRMELCVLGIHGQVQAGIDYLTAGRSASGEPIATSIIVSGGYEDDDDRGDILVY
TGHGGRDPNLHKHCVDQKLEGGNLALERSMAYGIEIRVIRAVKSKRSPVGKVYFYDGLYK
VVDFWLDRGKAGFGVYKYKMIRIDGQDAMGSVNYRVAERLKVDALSMRPTGYLSFDISMG
RESMPVALYNDVDDDKDPLLYEYLARPIFPSSAVQGKFAEGGGGCECIENCSIGCYCAQR
NGGEFAYDKAGVLLRGKPLVYECGPYCRCPPSCPNRVSQKGLKNRLEVFRSRETGWGVRS
LDLIKAGAFICEFSGIVLTHQQSEIVAVNGDCLVHPNRFPPRWLDWGDISDVYPGYVPPN
HPAIADLNFSIDVSRARNVACYFSHSCSPNVFIQFVLFDHYNMSYPHLMIFALENIPPLR
ELSIDYGMIDEWVGKLTM
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggaggagtcctcgccgtcgtcgccgttgtcttcgccgtcctcatccccttcg
tccgactccatcgacctcaacttcctgcccttcctgaagagggagcccaagtcggagccg
gcttccccggagcatgatcctcttccgcctccgcctccgcctccgcctccgccgcaggcc
gcggctgcagtcgcggttgcttatgtcgaccctacaccggcaacgccggacctgtcttcg
ccggcggtgatgacgccgctgcagtcgctgccgccaaaccctgacgaggacgcactcttc
gcggagtactgccggctcgcgagcctctacctgctatcggcgggggcaggggcgatcgtg
caagcgccgactccggaggccgcggcgccggcggtcgtgcagcctgggtcgggttccgct
gtgaagaagcgccggccacggtcgtcagagttggtgcgggtgtcctcgctgggcatgcgg
gatcagatctatttccgtgatgtggtgcgccgggcgcgcatcacatttgagtcgctgcgt
gggctgctgctcaaggacgacgagcgggcggaggctctcgggcttccaggcgtcgtcggg
cttgggtcaacggaccggcgccgcgtccgcgcggacctgcgggccgcagctctcatggcc
gaccgagacctgtggctcaaccgtgaccggcgaattgtgggaccaatccctgggatatct
gtaggggacgccttcttctttcgcatggagctatgtgttctgggtatccatggccaggtg
caggccggaatcgactacctcactgctggccggtctgcctcaggggagcctatagccaca
tctatcattgtgtctggtgggtatgaagatgatgatgaccgtggtgatatactggtgtac
accggccatggtggccgcgaccccaaccttcacaagcattgcgtcgaccagaagcttgag
ggtggtaaccttgccctcgagcgcagcatggcctatggtattgagattcgcgtaatccga
gcagtcaagtctaagcgcagtcctgtgggaaaggtctacttctatgatggcctctacaag
gttgttgacttctggctcgatcgcggcaaagctggctttggtgtttacaagtataaaatg
atacgcattgatgggcaggatgccatgggctctgtgaattatcgtgtagctgaacggctt
aaggtggatgcgttatctatgcgaccaactggatatttgagctttgatatttcaatgggc
cgagagagcatgcctgttgcactatataacgatgttgatgatgataaggacccgctctta
tatgagtatctggcaaggccaatattcccatcctctgcagtccaagggaagtttgctgag
gggggtggtgggtgtgagtgcatcgagaattgctccatcgggtgttattgtgcacaaagg
aacggcggtgagtttgcgtatgataaagctggtgttcttctacggggtaaaccactggtc
tacgagtgtggtccgtattgccgatgcccacctagctgcccaaacagggttagtcagaag
ggacttaaaaataggcttgaggtgttccggtcaagggagactgggtggggtgttcggtct
ttggatcttattaaagctggcgctttcatttgtgagttcagtgggattgtgcttactcat
cagcagtcagagatagtggctgtcaatggtgattgcttggtgcatccaaacaggttccct
ccaaggtggttagattggggtgatatctctgatgtgtatcctgggtatgtgccgccgaac
catcctgccattgctgacctgaacttttcaattgatgtgtcaagggcaaggaatgtggct
tgttatttcagccatagctgcagtccaaatgtttttatccagtttgtgctgtttgaccat
tacaacatgtcatatccccacctcatgatctttgccctggagaacattccaccattgaga
gagctaagcatcgactacggaatgattgatgaatgggttggaaagttaactatgtag

DBGET integrated database retrieval system