KEGG   Brachypodium distachyon: 100824846Help
Entry
100824846         CDS       T01717                                 

Definition
(RefSeq) B3 domain-containing protein Os11g0156000
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif
Pfam: B3 DUF313
Motif
Other DBs
NCBI-GeneID: 100824846
NCBI-ProteinID: XP_003577828
UniProt: I1INF2
LinkDB All DBs
Position
4
AA seq 277 aa AA seqDB search
MAMNPLSQEHHPNAWPWGVAMYTNLHYQQYHYEKEHLFEKALTPSDVGKLNRLVIPKQHA
ERCFPLGGDSGEKGLLLSFDDEAGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKQLDAGDV
VHFERVRGLGTGDRLFIGCRRRGDVGAPTPPPAVRVMPASGQNHPREQHQQQPWSPMCYS
TSGSYPTSPANSQAYRRSVDHDHSDMHHAGESQWDADGRTCSPASAPTRRLRLFGVNLDC
GPEPEADTSTATEAMYGYMHQIPYAAVSPVPSNWGSS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaatcctctctcccaggagcaccaccccaatgcatggccatggggggtggcc
atgtacacgaacctgcactaccagcagtaccactacgagaaggagcacctgttcgagaag
gccctgacgcccagcgatgtgggcaagctcaacaggctggtgatcccgaagcagcacgcc
gagaggtgcttccctctcggcggcgactccggggagaaaggcctcctgctgtccttcgac
gacgaggccggcaagccatggcggttcaggtactcgtactggacgagcagccagagctac
gtgctcaccaagggctggagccggtacgtcaaggagaagcaactcgacgccggagatgtc
gtgcacttcgagagagtgcgcggcctcggcaccggcgaccgtctgttcatcggctgcagg
cgccgcggcgacgtcggtgccccaacgccaccgcccgctgtgcgtgtcatgccggcgtcc
ggacagaaccaccccagggagcagcatcagcagcagccatggagtccaatgtgctacagc
acatccggctcataccctactagcccggccaactcccaagcctaccggcgctcagtagac
catgatcacagcgacatgcaccatgcaggggagtcgcagtgggacgcagatggcaggacc
tgcagcccagcctcggcgccgacaaggcggctcaggctgttcggcgtgaacctcgactgc
gggcccgagccggaggccgacacgtcgacggcgacagaggcaatgtacggctacatgcac
cagatcccctacgccgccgtgtctccagtgcccagcaactggggcagctcataa

DBGET integrated database retrieval system