KEGG   Brachypodium distachyon: 100825328Help
Entry
100825328         CDS       T01717                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00020  Citrate cycle (TCA cycle)
bdi00620  Pyruvate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
Module
bdi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100825328
   00020 Citrate cycle (TCA cycle)
    100825328
   00620 Pyruvate metabolism
    100825328
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100825328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PASTA
Motif
Other DBs
NCBI-GeneID: 100825328
NCBI-ProteinID: XP_003574513
UniProt: A0A0Q3M1M0
LinkDB All DBs
Position
3
AA seq 468 aa AA seqDB search
MAATPAPLSLSASALSARLRLAAPASRAASARRRGPMVVRAKIREIFMPALSSTMTEGKI
VSWSAAEGDRVTKGDAVVVVESDKADMDVETFYDGIVAAVLVPAGESAPVGAPIALLAES
EEDVALAVAQAQALSSGQAQQAPPPSDADAPPPPSPPPAAAAPAPVAAGTKGVATPQAKK
LAKQHRVDLAKVTGTGQFGRITPADVEAAAGIQPKPKVAPPTAAAPVAAPSVRAVPQASV
LPPVPGATVVPFTAMQAAVSKNMVESLSVPAFRVGYPILTDKLDELYEKVKPKGVTMTVL
LAKAAAMALAQYPVVNASCRDGASFTYNSSINIAVAVAIDGGLITPVLEQADKLDIYLLS
QKWKELVKKARAKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVT
ADKDGFFSVKNKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaccccggctcccctctcgctctccgcctccgcgctgtccgcgcgcctgcgc
cttgcggcgccggcgtcgcgcgcggcctcggcccggcggcgcgggccgatggtggtccgc
gccaagatccgggagatcttcatgccggcgctcagctccaccatgacggaggggaagatc
gtgtcctggtccgccgccgagggcgaccgcgtcaccaagggcgacgccgtcgtggtcgtc
gagtctgataaggccgacatggacgtcgagaccttctacgacggcatcgtggcggccgtc
ctcgtccccgcgggggagtccgcccccgtcggcgcccccatcgcgctgctcgccgagtcc
gaggaggacgtggcgctcgccgtcgcccaggcccaggcgctctccagcggacaggcccag
caggctcctcctccttctgatgccgacgctccgccgcccccgtccccgcctccggcggcg
gcagctcccgcgccggttgcagcagggacgaagggtgttgccacgccgcaggctaagaag
ctggccaagcagcacagggtggaccttgccaaggtgactggcaccgggcagttcggccga
attacgcctgctgatgttgaggcggcagccggcatccagccaaagcccaaggttgctcct
cctactgctgctgcacctgtggctgctccttccgtgagagctgtgccacaggcttcggtc
cttccgccggtacctggtgccacggtggttccattcactgcaatgcaggctgcagtgagc
aagaacatggtggagagcctgtcggtgccagcattccgtgtcgggtaccccattttgacg
gataagctcgatgagctctatgagaaggtcaagccaaagggggtgactatgactgtactg
cttgcaaaggccgcagctatggcgcttgcacagtatcctgtggtgaacgctagctgcagg
gatggtgcgagcttcacttacaatagttctatcaacattgctgtggctgtcgctattgat
ggtggcctcattacacccgttctagagcaagctgataagctggatatatatctactctca
caaaagtggaaggaattagtcaagaaggcacgtgcaaaacagctacagccaaatgagtac
aactctgggacatttacattgtccaacctcggtatgtttggtgtagatagatttgatgca
attcttccacctggccagggggctataatggctgttggggcctcaaaaccgacagtgacg
gctgataaagatggtttctttagcgtcaagaataaaatgctggtcaatgtcactgctgat
cacagaattgtttatggtgctgatttggcagcattcctgcaaacttttgcgaaaataatt
gaggatcccgagagcctaactttgtaa

DBGET integrated database retrieval system