KEGG   Brachypodium distachyon: 100826923Help
Entry
100826923         CDS       T01717                                 

Definition
(RefSeq) ent-kaurene oxidase-like 3 isoform X2
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00904  Diterpenoid biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    100826923
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bdi00199]
    100826923
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     100826923
Cytochrome P450 [BR:bdi00199]
 Cytochrome P450, plant type
  CYP701 family
   100826923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-GeneID: 100826923
NCBI-ProteinID: XP_003560644
UniProt: I1GXV3
LinkDB All DBs
Position
1
AA seq 487 aa AA seqDB search
MEALLAAVVVGVGMGQKHLTNAPPVVPGLPLIGNLHQLKEKKPHKTFAEWSDIYGPIYTI
NIGASSVAVLNSTEVAKEAMVAKYSSISTRKLPKALSVLTRDKTMVATSDYGDFHKKTKR
YVMMGVLGYSAQRKFQNTRGMMIDNMLRTYSTLVTDDPDSPLNFRKVFRDELFCLSLIQS
LGDDVGSVYVKEFGREISKEEIYQITVVDMIMCAIEVDWRDFFPYLQWVPNLSFETRVHT
AESRRTSVMRALIHQQKKRIACGEARVSYLDFLLAENTLTDEQLTMLVWEEVIEAADTTL
VTTEWAMYELAKNPEIQDRLYREIQDVCGDEKVTEDHLPRLPYLNAVFHETLRLHSPVPL
VPPRLVHEPTRLAGYDIPTGTEIIINLYGCNMNKEDWDEPKEWKPERFLDGSFNAADMYK
TMSFGAGRRVCAGSLQATNISCTAIARFVQEFAWRLKEGDEDKVDTVQLTNYKLHPLFVH
LSPRGGK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgctggccgccgtggtcgtcggcgtcggcatggggcagaagcacctcacc
aatgcgcccccagttgttcctggtttacctcttattggaaatcttcatcagttgaaagaa
aagaagccccataaaacatttgcagagtggtctgatatttatggtccgatatacactata
aacattggggcttcttctgtagctgtgctcaactcaacagaagtagcaaaggaggcaatg
gttgcaaaatattcatccatatctactcgaaagcttcctaaagcattgtcagtgctcact
cgagataaaactatggttgctacaagtgactacggtgatttccacaaaaagacaaagcgg
tatgttatgatgggcgtgttgggttattctgctcagagaaaatttcagaacacaagaggc
atgatgatagataacatgttgagaacttacagtacgttggtgactgatgacccagattct
cctctgaacttcagaaaagttttcagggacgagctattctgtttgtccttgatccagagc
ttaggtgacgatgtgggttcagtctatgtcaaggagtttgggagggagatatcaaaggaa
gaaatctaccagatcacggttgttgacatgattatgtgtgctattgaggtcgactggagg
gacttcttcccgtacctccaatgggtacccaacctgagctttgaaacaagagttcatact
gcggaatctaggcgaacctccgtcatgcgggccttgatccatcaacagaagaaaagaatt
gcgtgtggcgaggcaagggtatcctatctggacttcttgttggcagagaacacgctgaca
gacgagcaattgacgatgctggtatgggaggaagtcatagaggctgcagataccactttg
gtcactaccgagtgggctatgtacgagcttgccaaaaacccagaaatacaggatcgtctc
taccgggaaatccaggatgtgtgcggagacgagaaggtcacggaggatcacctgcctcgg
ctgccgtacctgaatgccgtgttccacgagacgctgcggctccattctcctgtcccactg
gtgcctccaaggctcgtccatgagcccaccaggctggccggctatgacatcccaaccggc
acagagatcatcatcaatttgtacgggtgtaacatgaacaaggaggactgggacgaaccg
aaggagtggaagccggagaggttcttggacgggagcttcaatgctgcggatatgtacaag
accatgtcgttcggagctggtaggagagtctgcgccgggagcctgcaagcgacgaacatc
tcttgcaccgccattgctcggttcgtgcaggagtttgcctggaggctgaaggagggcgat
gaggacaaggtggacaccgtccagctcaccaactacaagctccacccactgtttgtgcat
ctctcaccaagaggggggaagtaa

DBGET integrated database retrieval system