KEGG   Brachypodium distachyon: 100827187Help
Entry
100827187         CDS       T01717                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00250  Alanine, aspartate and glutamate metabolism
bdi00410  beta-Alanine metabolism
bdi00430  Taurine and hypotaurine metabolism
bdi00650  Butanoate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Module
bdi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100827187
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100827187
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100827187
   00430 Taurine and hypotaurine metabolism
    100827187
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100827187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 100827187
NCBI-ProteinID: XP_003574600
UniProt: I1I7Q1
LinkDB All DBs
Position
3
AA seq 499 aa AA seqDB search
MVLSRAISSAGDSVACTFASRYVREELPRYRMPEQSIPKEAAYQIITDELMLDGNPRLNL
ASFVTTWMEPECAKLMMDSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDETAIG
VSTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTEGYYVMDPLKAVEMVDENTICVAAILGSTLTGEYEDVKLLNDLLVEKNKETGWNVP
IHVDAASGGFIAPFLQPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKDDLPDEL
IFHINYLGTDQPTFTLNFSKGASQIIAQYYQLIRLGFEGYKHIMENCKGNAAILREGIEA
TGRFKVLSKEDGVPLLAISLKDSTGFTVFDISENLRRFGWIVPAYTMPADAEHVAVLRVV
IREDFSRSLAQRLIADINKVLRELDAHAVHAVKITTAVATQASEGMDDGVVTKKSVLDTE
KEFASACMDLLKNKKTGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcgcgcgcgatctccagcgcgggcgactccgtcgcctgcaccttcgcctcg
cgctacgtccgcgaggagctcccgcggtaccggatgccggagcagtcgatcccaaaggag
gcggcgtaccagatcatcacggacgagttgatgctggacgggaacccgcgcctgaacctc
gcctccttcgtcaccacgtggatggagccagagtgcgccaagctcatgatggactccgtc
aacaagaattacgtcgacatggacgagtaccccgtcaccaccgagctccagaaccgttgt
gtaaatatgatcgctcacctgttcaatgcgcccatcaaggaggatgagacagctattgga
gtttcaacagtgggatcctccgaagcaattatgcttgcaggtttggcattcaagaggaag
tggcaaaataagaggaaggagcaggggaagccatgtgacaaacctaacattgttaccggt
gcgaatgttcaggtttgctgggaaaaatttgcaagatattttgaagtagaattgaaggag
gtcaagttaactgaaggatactatgtcatggatcctttgaaggctgttgaaatggtggat
gaaaatactatctgtgttgcagccatcttgggatctactctaactggagagtacgaagat
gttaaattattgaatgaccttcttgtggagaagaacaaggaaactgggtggaatgtgccg
atacatgttgatgcggcaagtggaggatttatagccccttttcttcagcctgagcttgaa
tgggacttcaggctaccattggtgaagagcatcaatgttagtgggcacaagtatggcctt
gtttaccctggtgttggttgggtcatttggcggagcaaagacgatttgcctgacgaactc
attttccacataaactatctagggacagatcagcccacattcacactgaacttctccaaa
ggtgctagtcagataattgcacaatactaccaactgatacgtctaggcttcgagggatac
aagcacatcatggaaaactgcaaggggaatgcagccatactgagggagggaatagaggcg
acaggaaggttcaaagtcctctccaaagaggacggcgtacctctgctagctatctcgctc
aaagacagcactggattcaccgtgttcgacatctccgagaacctgaggaggttcggctgg
atcgtgccggcctacaccatgcctgcggacgcggagcacgtggccgtcctccgcgtcgtc
atcagggaggatttcagccggagccttgcccagcggctcatcgcagacatcaacaaggtc
ctacgcgagctggacgcgcacgcggtccacgccgtgaagatcaccactgcggttgctacg
caagccagcgagggcatggatgatggcgtggtgacgaagaagagcgtcctggacaccgag
aaggagttcgcctcggcctgtatggacctgcttaagaacaagaagacaggggtctgctga

DBGET integrated database retrieval system