KEGG   Brachypodium distachyon: 100827308Help
Entry
100827308         CDS       T01717                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
bdi  Brachypodium distachyon
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bdi01001]
    100827308
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100827308
Protein kinases [BR:bdi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100827308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo APH FTA2 Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 100827308
NCBI-ProteinID: XP_003557972
UniProt: I1H5S7
LinkDB All DBs
Position
1
AA seq 481 aa AA seqDB search
MVSSEINSVTTTHAQGPKLFTGTIILPKGPPDVVVPENIEFDFNDVFGATAVQTPTEVSI
LTPESPAPFAESSDEVYNDPVVITKRSHSLVGPTSLVSQSLPLSKLTLHETDSTPDLLEC
LSKEKESNQDQLSDEELTNPKKENEVVGLDDFEVLKLVGQGAFGKVYQVRKKGTSEIYAM
KVMRKDKILEKNHAEYMKAERDILTKVDHPFVVQLRCSFQTKYRLYLVLDFVNGGHLFFQ
LYQQGLFREELARIYTAEIVSAVSHLHANGIMHRDLKPENILLDDHGHAMLTDFGLAKEF
DENTRSNSMCGTVEYMAPEIVQGRGHDKAADWWSVGILLFEMLTGKPPFFGGNRDKIQQK
IVKEKMKLPAYLSSEVHSLLKGLLHKEAGRRLGSGPGGSDEIKNHKWFKSVNWKRLEARQ
IQPSFCPNVAGQTCIANFDECWTSMPVQDSPVASPVAADSNFLGFSYVRPAPFLQRPSPL
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctgagataaattctgttacaacaactcatgcacaggggcccaagctcttc
acagggaccataattctgccaaaagggcctccagatgttgtagttcctgaaaatattgag
tttgattttaatgatgtttttggtgccacggcagtccagacacccacagaagtaagcatt
ctcactccagagagccctgcacctttcgctgagtccagtgatgaggtatacaatgatcct
gtagtcattaccaagcgatctcattctcttgttggtccaacctcacttgttagccagtcc
ttgccacttagtaagcttacactgcatgagacggatagcacgccagatcttttagagtgt
ctttctaaagaaaaggaaagtaatcaggatcaacttagtgatgaagagctaaccaatcca
aaaaaggagaacgaggttgttggactcgatgactttgaagtcttgaagcttgtgggccaa
ggggcatttggcaaagtctatcaggtgagaaagaaaggtacttctgaaatatatgcaatg
aaagtcatgaggaaggacaagattttggagaagaaccatgctgagtacatgaaagccgag
agagatatactgacaaaagttgatcatccttttgtggtgcagctgagatgctcctttcag
acaaagtaccgactttaccttgtcctggactttgtgaatgggggccatctcttcttccag
ctttaccaacagggcttgtttagggaggaacttgcgcgcatctatactgctgaaatcgta
tctgctgtatcccaccttcatgccaatgggattatgcatagagatctgaagcctgagaac
atcttattggatgatcatggtcatgccatgctgaccgattttggtctggcaaaggaattt
gatgaaaacactagatcaaactcaatgtgtggcactgtggagtatatggctccagaaatt
gttcagggccgaggtcatgataaggctgcagactggtggagcgtggggatccttcttttt
gagatgcttacgggcaagcccccattttttggtggaaacagggacaaaattcagcagaag
atcgtgaaggagaagatgaaacttccggcttatttgtctagtgaagtccattctctgttg
aaaggcctactgcacaaggaagctggcaggcgacttggaagtggaccaggcggcagtgac
gaaataaagaaccacaagtggttcaagtcagtaaactggaagagactcgaggctcgacag
atccagccaagcttctgccctaatgttgctggtcagacctgcatcgcaaacttcgacgag
tgctggacgagtatgcccgtgcaggactctccggtggccagccccgtcgctgcagacagt
aacttcctggggttcagttacgtgcggcccgcgccattccttcaaaggccgagtcctcta
ggctga

DBGET integrated database retrieval system