KEGG   Brachypodium distachyon: 100829841Help
Entry
100829841         CDS       T01717                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain PWS4.3, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00630  Glyoxylate and dicarboxylate metabolism
bdi00710  Carbon fixation in photosynthetic organisms
bdi01100  Metabolic pathways
bdi01200  Carbon metabolism
Module
bdi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bdi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bdi_M00532  Photorespiration
bdi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100829841
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100829841
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     100829841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 100829841
NCBI-ProteinID: XP_003577109
UniProt: I1IIX6
LinkDB All DBs
Position
4
AA seq 174 aa AA seqDB search
MAPTVMASSATSVAPFQGLKSTAGLPLSRRSSNSLGRVSNGGRISCMQVWPIEGIKKFET
LSYLPPLSVESLLKQIEYLIRSKWVPCLEFSKVGFVFREHNSSPGYYDGRYWTMWKLPMF
GCTDATQVLKELEEVKKEYPDAYVRIIGFDNTRQVQCISFIAFKPPGCEESGKA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaccgtgatggcttcctccgccacctccgtggcccctttccagggcctcaag
tccaccgccggcctccccctcagccgccgctcctccaacagcctcggccgcgtcagcaac
ggcggaaggatcagctgcatgcaggtgtggccgatcgagggcatcaagaagttcgagacc
ctctcgtacctgccccctctctccgtggagtctctcctgaagcagatcgagtacctgatc
cgctccaagtgggttccttgccttgagttcagcaaggtcggctttgtgttccgtgagcac
aacagctctcctgggtactacgacgggaggtactggacaatgtggaagctgcccatgttc
gggtgcaccgacgccacgcaggtgctcaaggagctggaggaggtcaagaaggagtacccg
gacgcctacgtccgcatcatcggcttcgacaacacccggcaggtgcagtgcatcagcttc
atcgccttcaagccaccgggctgcgaggaatccggcaaggcataa

DBGET integrated database retrieval system