KEGG   Brachypodium distachyon: 100831056Help
Entry
100831056         CDS       T01717                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100831056
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100831056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 100831056
NCBI-ProteinID: XP_003574947
UniProt: I1I9J4
LinkDB All DBs
Position
3
AA seq 204 aa AA seqDB search
MASVTAAAQTTLLSAATAPTSLFQAAPSSARPFHPLRLVSAGRRTLVVADATKKAVAVLK
GTSQVEGVVTLTQEDDGPTSVNVRITGLTPGLHGFHLHEFGDTTNGCISTGPHFNPNGLT
HGAPGDEVRHAGDLGNIVANAEGIAETTIVDSQIPLSGPNAVVGRAFVVHELEDDLGKGG
HELSLSTGNAGGRLACGVVGLTPL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgtcaccgccgccgcgcagaccaccctcctctccgccgcgaccgcccctacg
tcgctcttccaggcggccccgtcctctgcccgccctttccacccgctccgcctcgtctcc
gcgggcaggaggacgctcgtcgtcgccgacgccaccaagaaggccgtcgccgtgctcaag
ggcacctcccaggtcgagggcgtcgtcacgctcacccaggaagacgacggtcctacgtcg
gttaacgtccgtatcactgggcttactcctggacttcacggcttccacctccatgagttt
ggcgacacgactaatgggtgcatctcaacaggaccacactttaacccaaatggcctgaca
catggtgcaccaggggatgaagtccgtcatgcgggtgacctgggaaacattgttgccaat
gctgaaggcatagctgagacaaccattgtcgatagccagattcctttgagcggtccaaat
gctgtcgttgggagagcatttgttgttcatgagcttgaagatgatttgggaaaagggggg
catgagctcagcctcagtactggaaatgctggtggacggctagcatgtggtgttgttggc
ctgactccgttgtag

DBGET integrated database retrieval system