KEGG   Brachypodium distachyon: 100831298Help
Entry
100831298         CDS       T01717                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00250  Alanine, aspartate and glutamate metabolism
bdi00410  beta-Alanine metabolism
bdi00430  Taurine and hypotaurine metabolism
bdi00650  Butanoate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100831298
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100831298
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100831298
   00430 Taurine and hypotaurine metabolism
    100831298
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100831298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 100831298
NCBI-ProteinID: XP_003560535
UniProt: I1GNX4
LinkDB All DBs
Position
1
AA seq 497 aa AA seqDB search
MVLSHAVSAGSSDDSVHSTFASRYVRAALPRFRMPENSIPKEAAYQIINDELMLDGNPRL
NLASFVTTWMEPECNKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETA
VGVGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVEL
KEVKLREGYYVMDPEKAVELVDENTICVAAILGSTLNGEFEDVKMLNDLLVKKNEETGWD
TPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPE
ELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMDNCRENAKVLKEGL
EQTGRFNIVSKDEGVPLVAFSLKDSSRHDEFEISEFLRRFGWIVPAYTMPPDAQHVTVLR
VVIREDFSRTFAERLVIDIEKVLHELDALPSRGGPPSLTSANANGDAPSERDIERQREVV
AIWKMAVLAKKKTNGVC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccacgccgtgtcggcaggatcgtccgatgactcggtgcactccaccttc
gcctcccgctacgtccgcgccgctctgcccaggttccggatgccggagaactcgatcccg
aaggaggcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctg
aacctggcgtccttcgtcaccacctggatggagcccgagtgcaacaagctcatgatggac
tccatcaacaagaactacgtcgacatggatgagtacccggtcaccaccgagctccagaac
cgatgcgtgaacatgatcgcgcatctcttcaatgctcctctcggggagacggaaacggcc
gtcggagtcggcacggtcggctcgtctgaggccatcatgctcgccgggctggccttcaag
aggcggtggcagaacaagatgaaggccgccggcaagccctgcgacaagcccaacatcgtc
accggcgccaacgtccaagtttgctgggagaagtttgcccgctacttcgaggtggagctc
aaggaagtgaagctgcgcgaggggtactacgtgatggaccccgagaaggccgtggagctg
gtcgacgagaacaccatctgcgtcgcggccatcctcggctcgacgctcaacggggagttc
gaagacgtcaagatgctcaacgacctcctcgtcaagaagaacgaggaaacaggctgggac
acgccgatccacgtggacgcggccagcggtgggttcatcgcgccgttcctgtaccctgag
ctggagtgggacttccgtctgccgctggtgaagagcatcaacgtgagcgggcacaagtac
gggctcgtctacgccgggatcgggtggtgcatctggaggagcaaggaggacctgccggag
gagctcatcttccacatcaactacctcggtgccgaccagcccaccttcaccctcaacttc
tccaaaggttccagccaagttattgctcagtattaccagctgatccgccttggcttcgag
gggtacaagaacatcatggacaactgccgggagaacgcgaaggtgctcaaggaaggcctg
gagcagacgggtcggttcaacatcgtgtccaaggacgaaggggtgccgctggtggccttc
tccctcaaggacagcagccggcacgacgagttcgagatctccgagttcctgcgccgcttc
ggctggatcgtgccggcctacaccatgccccccgacgcgcagcacgtcacggtgctccgc
gtcgtcatcagggaggacttcagccgcaccttcgccgagcgcctcgtcatcgacatcgag
aaggtgctgcacgagctcgacgcgctgccgtcgcgcggcgggccgccatcgctgacgagt
gccaacgctaacggcgacgcgccgagcgagagggacattgagaggcagcgcgaggtggtc
gccatctggaagatggctgtcctggccaagaagaagaccaacggcgtctgctga

DBGET integrated database retrieval system