KEGG   Brachypodium distachyon: 100833155Help
Entry
100833155         CDS       T01717                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00053  Ascorbate and aldarate metabolism
bdi00071  Fatty acid degradation
bdi00280  Valine, leucine and isoleucine degradation
bdi00310  Lysine degradation
bdi00330  Arginine and proline metabolism
bdi00340  Histidine metabolism
bdi00380  Tryptophan metabolism
bdi00410  beta-Alanine metabolism
bdi00561  Glycerolipid metabolism
bdi00620  Pyruvate metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100833155
   00053 Ascorbate and aldarate metabolism
    100833155
   00620 Pyruvate metabolism
    100833155
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100833155
   00561 Glycerolipid metabolism
    100833155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100833155
   00310 Lysine degradation
    100833155
   00330 Arginine and proline metabolism
    100833155
   00340 Histidine metabolism
    100833155
   00380 Tryptophan metabolism
    100833155
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100833155
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    100833155
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100833155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100833155
NCBI-ProteinID: XP_003563967
UniProt: I1GZ41
LinkDB All DBs
Position
1
AA seq 548 aa AA seqDB search
MAAAATRRAASSLVSRCLLGRPAASPAVPSAFRRADGTRGLVPGVLQRFGTAAVAEEPIS
PPVKVGETKLLINGKFVDAVSGKTFPTLDPRTGEVIAHVAEGDAKDIDLAVAAARKAFDE
GPWPRMTAYERSRILLRFADLIEKHNDDLAALETWDNGKTFEQAAHIELPMIARLMRYYA
GWSDKIHGLVVPADSPHHVQVLYEPIGVAGQIIPWNFPLLMFAWKVGPALASGNTVVLKT
AEQTPLSALYMAKLLHEAGLPEGVVNVVSGFGPTAGAALASHMDVDKVAFTGSTDTGKII
MELSARSNLKPVTLELGGKSPFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHER
VYDEFVEKSKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIKSGVDSGATLVTGGDK
LGDKGYYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASRYGLAAGVFT
NNLGTANTLTRALRAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQTKAVVT
PIKNAAWL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgcaacgaggagggccgcctcctccctcgtctcccgctgcctgctcggc
aggcccgcagcgtcgcccgctgtcccctccgccttccgcagggcagatgggacacgagga
ctggtgccgggagtccttcagaggtttggcactgcagcagtagcagaggaacctatttca
ccacctgttaaagtgggagagacaaagcttcttatcaatggcaaatttgttgatgctgta
tctggtaagacttttccaactctggaccctcgtactggggaggtgattgctcatgtggct
gaaggtgatgccaaagacattgacctcgctgttgctgcggcccgcaaggcattcgatgaa
ggaccatggccaaggatgactgcctacgagagatcccggattcttctgcgatttgctgat
cttatagagaagcacaatgatgatcttgctgcattggagacttgggacaatggaaagacg
tttgagcaagctgcccacattgaattgcctatgattgcgcggcttatgcggtactatgct
ggttggtctgacaagatccatggtctcgtcgtgccggctgacagcccacaccatgtacag
gtcctttatgagccgatcggtgttgcgggccagatcatcccttggaacttcccacttttg
atgtttgcctggaaagtcggtcctgccttggcgtctgggaacactgttgtgctcaagact
gcggaacaaactcctctgtctgccctgtatatggctaagctgttgcatgaggctggactc
cccgagggtgtcgtgaacgttgtatctggttttggtcctactgctggtgctgcccttgct
agtcacatggatgttgataaggttgcattcactggatcaaccgatactggcaaaattatc
atggagttgtctgcaaggagcaatctcaagccagtgacactcgagctaggtggcaagtct
ccttttatcatcatggatgatgctgatattgaccatgctgttgagcttgcgcattttgcg
ctgttctttaaccagggacaatgctgctgtgctgggtctcgcacatttgtacatgagcgt
gtttacgatgagtttgttgagaagtcgaaagctcgtgctttgaagcgtgtagttggtgac
ccattcaggaaaggtgttgaacagggccctcagattgatgatgagcaattcaacaaaatc
ttgcgctacattaagtcaggtgttgacagtggagccacccttgtgacgggtggtgacaag
ttaggtgacaaaggttactacatccagccaacaatcttctcagatgtgcaggatggcatg
aagatagctcaagaggagatatttgggcctgttcagtcaatcttcaagttcaatgatctc
aacgaggtcatcaagagggcgaacgcgagccgctacggattggccgccggtgttttcacc
aacaacctgggcacagccaacaccctgacacgtgcgctcagggctgggactgtctgggtg
aactgcttcgacatcttcgacgcggcgatccccttcggcgggtacaagatgagtggcatc
ggtagggagaagggcatcgacagcctgaagaactacctacaaacgaaggcagtcgtcacc
ccaattaagaacgccgcgtggttgtga

DBGET integrated database retrieval system