KEGG   Brachypodium distachyon: 100833284Help
Entry
100833284         CDS       T01717                                 

Definition
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00220  Arginine biosynthesis
bdi00250  Alanine, aspartate and glutamate metabolism
bdi00270  Cysteine and methionine metabolism
bdi00330  Arginine and proline metabolism
bdi00350  Tyrosine metabolism
bdi00360  Phenylalanine metabolism
bdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bdi00710  Carbon fixation in photosynthetic organisms
bdi00950  Isoquinoline alkaloid biosynthesis
bdi00960  Tropane, piperidine and pyridine alkaloid biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
bdi01210  2-Oxocarboxylic acid metabolism
bdi01230  Biosynthesis of amino acids
Module
bdi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
bdi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100833284
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100833284
   00270 Cysteine and methionine metabolism
    100833284
   00220 Arginine biosynthesis
    100833284
   00330 Arginine and proline metabolism
    100833284
   00350 Tyrosine metabolism
    100833284
   00360 Phenylalanine metabolism
    100833284
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100833284
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    100833284
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    100833284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bdi01007]
    100833284
Enzymes [BR:bdi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     100833284
Amino acid related enzymes [BR:bdi01007]
 Aminotransferase (transaminase)
  Class I
   100833284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100833284
NCBI-ProteinID: XP_003571894
UniProt: I1HZ43
LinkDB All DBs
Position
3
AA seq 430 aa AA seqDB search
MAALSRAASAIRRRGALHLLPGGAPTRAMASLFGHVEPAPKDPILGVTEAFLADPSPDKV
NVGVGAYRDDNGKPVVLDCVREAERRIAGNLNMEYLPMGGSIKMIEESLKLAYGEESEFI
KDKRIAAVQALSGTGACRLFADFQKRFLPDSQIYIPTPTWSNHHNIWRDAQVPQRTFSYY
HPESRGLDFAGLMDDIKNAPNGSFFLLHACAHNPTGVDPTEEQWREISYQFKLKNHFPFF
DMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILCEDEMQAV
AVKSQLQQIARPMYSNPPVHGALVVSIILNDPDLKSLWLKEVKGMADRIIGMRKALRENL
EKLGSPLSWEHVTNQIGMFCYSGMTPEQVDRLTNEYHIYMTRNGRISMAGVTTGNVAYLA
NAIHDVTKSN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgtcccgcgcggcctccgcgatccggcggcggggtgccctgcacctgctg
cccggtggtgcgccgacgagggcgatggcgtcgctcttcgggcacgtcgagccggccccc
aaggaccccatcctcggcgtcaccgaggccttcctcgccgacccgtcccccgacaaagtc
aacgtcggcgtcggcgcctaccgggacgacaacggcaagcctgtcgtgctcgactgcgtg
cgtgaggcggagcgccggatcgccggcaacctcaacatggagtaccttccaatgggagga
agtatcaagatgattgaagagtcactaaagctggcatatggggaggaatctgagttcatc
aaagataaaagaattgcagcggtgcaggcgctttcaggtactggtgcatgccggctcttt
gctgacttccagaagcgtttcttgccagattcacagatctatatacctacaccaacgtgg
tccaaccatcacaatatttggagggatgctcaagtgccacagaggacattctcatattac
catccagaatcgagagggcttgattttgcaggactaatggatgatatcaagaatgctcca
aatggttcgttctttttgcttcatgcatgtgcccacaatcctactggagtagatcctaca
gaggaacagtggagagagatttcctatcagttcaagttgaagaaccatttcccattcttt
gacatggcataccaaggatttgctagtggtgatccagagagagatgccaaggcaatccgg
atcttccttgaagatggacaccagataggatgtgctcaatcatatgcaaagaacatgggg
ctttatggacagagagcaggatgcctgagtattctgtgtgaggatgagatgcaagcagtt
gctgtcaagagccaattgcagcagatcgcaagaccaatgtacagcaacccacctgttcat
ggcgcgctggttgtttctataatcctaaatgatccagacttgaaaagcttatggttgaaa
gaggtcaagggtatggctgatcgtatcattgggatgcggaaggcacttcgggaaaatctt
gaaaagttaggttcacctttgtcatgggagcatgtcaccaatcagattggaatgttctgc
tacagtgggatgacacctgaacaggttgatcgcttgacaaatgaataccacatttacatg
acccgcaatgggagaataagcatggctggtgtaacaacaggaaatgttgcttatttggcc
aatgctattcatgatgtcactaaatcaaattga

DBGET integrated database retrieval system