KEGG   Brachypodium distachyon: 100835014Help
Entry
100835014         CDS       T01717                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 100835014
NCBI-ProteinID: XP_010232149
UniProt: A0A0Q3GDH1
LinkDB All DBs
Position
2
AA seq 1399 aa AA seqDB search
MASLLCSPATKSFSVDTSTLFLSSLASLSPAQTHPISAPSATPPVPATVPSTALIPNSSF
LVDAFRHAGDFSVAYFLSHFHSDHYAGLGPSWRRGLVFCSAPTARLLASVLSVPSELIVS
IDIGARITVDGWGVVAVDANHCPGAVQFLFTSPGPNTKRYVHTGDFRYTDSMRSDPNLLE
FVGADAVFLDTTYCNPKFTFPSQEESVEYVVNTIKQVKEESEAAGERVLFLIATYVVGKE
KILLEVARRCGCMIHVDSRKMKILTGLGFGGEKGVFTEDAAASDVHVTGWNILGETWPYF
RPNFVKMKEIMMERGYTKAVSFVPTGWMYETKKEGFAVRVKDSLKIHLVPYSEHSSYDEL
REYVKFLHPKQVIPTVGVDGGKLDGKEAIALKKHFAGLVDETANKHEFLSVFHPRSICAT
LNHEDVLAKCLRDQDGEEFASLPEINNASELSDSSNIKITEEMKKELSDFLPSWVSQDQI
LGLLMRSGGDVVQSASDFFERERDFFEEANVSNNEMSKSGGIHTSDHGPSADVSSQQEVT
LFSEKPMEPSTKLVNLTPVRMNSNLPKKERKRVSSTANKSKKKGRSAASTESGGRKQPTI
TNYFGRAMAAASKSETANKVTVDPYENIGEKENDTQLTDIVKTHEQGINQLLQIVDGSMS
RESAISLLEKTKGDVNVAVDMFYSKIQNNNVPVNDKSIVPQNTQNEIIDKNSNSDIIQSS
SQATPKMQNLYVQTSLAQADSMNISLPVEKYLPIEHACWTTGQPAPYLHLARTFDLVERE
KGKIKSTAMLCNMFRSLLALSRDDVLPAVYLCTNKISPGHENMELNIGGSLIISALVESL
GTSRSKIHEMYKTHGDLGDVAQECRQNQTLLAPPRPLSIRDVYSTLRKLSAISGGGSAGR
RKILVLHLIRSCREMEMKFLVRTLARNLRIGAMMKTILPALAHAVVLDGKCAKNTVVSLE
GIKSELQGLSSEVTEAYNVIPNMDLLVPSLLREGTTFAASSLAMLPGTPIPPMLARITNG
LTQALKLFDGRAFTCEYKYDGQRAQIHRLTGGSVQIFSRQMKDSTSRFPDLVNMIKELCS
PEVASFVLDAEVVGIDRNKGNKLMSFQELSSRERGSKHSSITIQNIKVDICVFVFDIMFC
NGERLLDYPLRQRRNYIHDYFQEKPGHFELAQQLIVEKNEASVDNSSTLHRMSSFFEKAC
QSSCEGIMLKTLDVDAGYSASKRCDSWLKVKRDYVEGLGDSLDLVPIGAWYGNGRKAGWY
SPFLMACYNPDYEEYQSVCRVMSGFSDEFYKEMKEFYSEERILPKKPVYYKTDELPELWF
SAEQVWEIRGADLTLSPVHHAATGIVHPSRGISVRMPRYIRSVPDRSPEDCSTATDVACM
FKAQTRKMEVSSDGPASSH
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcctctgctctcccgccacaaaatccttctccgtcgacacctccacgctc
ttcctctcctccctggcgtcactgtcgcccgcccagacccaccccatctccgccccctcc
gcgaccccgcccgtcccggccaccgtaccatccacagctctcatccctaactccagcttc
ctcgtcgacgccttccgccacgctggcgacttctccgtcgcctatttcctctcccacttc
cactccgaccactacgccggcctcggcccctcctggcgccggggcctcgtcttctgcagc
gctcccaccgcgcgcctcctcgcctctgtgctatccgtaccttcggagctcatcgtctcc
attgacattggcgcccgcatcaccgttgatggctggggcgtagtcgccgtcgatgccaac
cactgccctggtgccgtccagttccttttcacctcccctggaccaaacacgaagaggtat
gtacacaccggggacttccgctatacggattctatgagaagcgaccctaatctgctggaa
tttgtcggtgctgatgctgtatttctggacaccacctactgtaaccccaaatttacattt
ccttctcaagaggagtcagtggaatatgttgtgaacacaataaagcaggtgaaggaggag
agtgaggcagccggagagcgtgtgctgtttttgatcgcgacttatgttgtaggcaaagag
aagattttgctggaggttgcacggcgctgtgggtgcatgatacatgtggatagcaggaag
atgaaaattttgacaggactggggtttggtggtgagaaaggagtttttactgaggacgca
gcagcatcagatgtgcatgttacagggtggaatattttgggggagacatggccctatttc
cggccgaattttgtgaaaatgaaggagatcatgatggagagagggtacaccaaggcagtt
agttttgtgccgaccggatggatgtatgaaaccaagaaggaagggtttgctgttagggtg
aaggattcactcaagatacatcttgtgccttatagtgagcactcgagctatgatgagttg
cgggagtacgtgaagttcttgcacccaaaacaggtcatcccaactgtgggagtcgatggt
gggaagcttgatggtaaggaggcgattgctctgaagaaacattttgcgggattagtggac
gagacggcgaataaacacgagttcttgtcagtgttccatccaagatcgatatgtgctact
cttaaccatgaggatgtgctggctaaatgcttaagggatcaagatggggaggagtttgct
tccttaccagaaatcaataatgcttctgaattatcagacagttcaaacattaagattaca
gaggaaatgaagaaagaactatcagatttcctaccatcatgggtcagccaggaccaaatc
ctaggcctgttgatgaggtcaggtggtgatgttgttcaatcagcatctgatttttttgag
cgggaaagagatttctttgaagaagcaaatgtttctaataatgaaatgtctaagtcaggg
ggaatccacacttctgatcatggaccttctgctgatgtaagtagtcagcaggaagtaact
ttattttcagagaagcccatggagccttctacaaagctggtgaacttgactcctgtgaga
atgaactcgaatcttcccaagaaggaaaggaagagggtttctagcactgcaaacaagtca
aaaaagaaaggaaggtctgctgcctcaacagaatctggtgggcgcaaacagcccacaatt
acaaactattttggtagagcaatggcagctgcttctaaaagcgagaccgccaataaagta
acagtggacccatatgaaaacattggagagaaggagaatgacactcagttaactgatatt
gtaaaaacgcacgagcagggcataaaccagcttcttcagattgtagatggcagcatgtcc
agagaatctgcaatttctttacttgagaagacgaaaggagatgtcaatgtagcagttgac
atgttctacagtaaaatccaaaacaataacgtacctgttaatgacaagagtattgtaccg
cagaatactcaaaatgaaattatagataaaaatagtaactcagacatcattcaaagctct
tctcaggctactccaaagatgcaaaacctgtatgtacaaacttctttagcacaagcagat
tcgatgaatatatcattgccagttgaaaagtatctgccgattgagcatgcttgctggaca
acaggacagcctgcgccatacctgcatttggctcgcactttcgatctggttgagagagaa
aaaggaaagatcaaaagtactgccatgctttgcaacatgttcaggagtttgcttgcctta
tcacgagatgatgtgctacctgctgtttatctatgtactaacaaaatttctcccggccat
gaaaatatggaactaaacattggcgggagtctaattatttctgctctggtggagtcatta
ggaaccagcagatctaaaatacatgagatgtacaaaactcacggcgatcttggtgatgtg
gcccaagaatgccgtcaaaatcaaacgctacttgctcctcctcgtccactctcaatccgt
gatgtatattccacacttcgaaagctaagtgcaatatcaggtggtgggagtgctggaagg
agaaaaattcttgtcttgcatcttattcggtcttgcagagaaatggaaatgaaatttctt
gttagaacactggcacgtaacttgcgtattggggctatgatgaagacaattttacctgct
cttgcgcatgctgttgttcttgatggaaaatgtgcaaaaaacacagtggtatccttggag
ggcatcaaatcagaattgcagggcctttcaagtgaagttactgaggcatacaatgtcatt
cctaatatggatttgcttgtcccctctcttttgagagaaggcactacatttgcagcttcg
tccttagcaatgctacctggcacacctattccacctatgcttgcaagaattactaatggg
ctcactcaagcactgaaattgtttgatggtagagcatttacttgtgagtacaagtatgat
ggtcagcgtgcacagattcacagattaactggtggatccgtgcaaatattttcaaggcag
atgaaagattcaacttctcgatttcccgatctagtgaatatgatcaaagagttgtgcagc
cctgaggtggccagctttgtactggatgctgaagttgtgggaattgatagaaataaagga
aacaagctgatgtcattccaagaattgtcttcgagagagagagggagcaagcactcctca
attacaattcagaatataaaggttgacatctgtgtgtttgtttttgatatcatgttctgc
aatggagagaggctattggattaccctcttcgacaaaggagaaactatatccatgactat
tttcaggagaagccaggacactttgagttagctcagcagctaattgttgaaaaaaatgaa
gcatctgtggataattctagcactttacacagaatgagcagctttttcgaaaaggcatgt
cagtcttcttgtgagggtataatgttgaagactctagatgttgatgctggatactctgct
tccaagcgctgtgattcgtggttaaaggtcaagcgcgactatgtggaaggccttggtgat
agccttgacttagttcccatcggtgcatggtatggaaatggacggaaagctggatggtac
agcccttttcttatggcatgctacaatcctgactatgaagaatatcaaagtgtctgccgt
gttatgtctggtttctcagatgaattctacaaagagatgaaggagttttattctgaagaa
aggatactgcccaagaaacctgtttactacaaaacagatgagctgccagagttgtggttc
agtgctgaacaagtttgggagatccgaggtgcagaccttacattatcccctgtacaccac
gcggcaactgggattgtccatccgtcgcgtgggatctcggtgaggatgccgaggtacata
cgctctgttccagatcggagcccagaggactgtagcacggctacggatgttgcttgcatg
ttcaaagctcagaccaggaagatggaggtcagcagcgatggccctgccagcagtcactag

DBGET integrated database retrieval system