KEGG   Brachypodium distachyon: 100837232Help
Entry
100837232         CDS       T01717                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00564  Glycerophospholipid metabolism
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100837232
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100837232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA NAD_binding_8 Lycopene_cycl FAD_binding_3 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 100837232
NCBI-ProteinID: XP_003581351
UniProt: I1IWE7
LinkDB All DBs
Position
5
AA seq 632 aa AA seqDB search
MAAWRLRRAGTALAASSALAAAAAAASAWSSASASDSTPVALGAARQRVTQPGAAAPPRA
AQLAALAGSTAAEPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALKERKQVIENAPHLCHALPCMTPCFNWFEVVYYWF
GLKFYDIVAGRRLLHLSRYYSVEESVELFPTLARNDGDRSLRGTVVYYDGQMNDSRLNVG
LACTSAVVGAAILNYAEVISLIKDESGERIIGAHIRDALSGKEFDTFAKVVVNASGAFCD
NVRKMANSDVVPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTT
DSSTAITMLPEPHEDEIQFILDAICDYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESIS
RDHVVFEDYPGLITITGGKWTTYRSMAEDAVNAAIRSGNLKPANDCVTDHLHIAGGYGWD
PASFTVLAQNFKRMKKTYGGKVIPGAMDSAVSKHLSHAYGTLAEQVAAIAQNEGLGKRLA
HGYPFLEAEVAYCARHEYCESAVDFVARRCRLAFLDTDAAGRALPRIIEILASEHKWDKA
RRKLELQKGIEFLETFKSSKNAQFRDGKHNGQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtggcgcctccgccgcgccggcaccgctctcgctgcctcctccgcactcgcc
gcggcggcggccgccgcgtcagcctggtcgtcggcgtccgcgtccgactccacccccgtg
gccctcggggccgcgcggcagcgcgtgacgcagccgggggctgccgcccctcctcgcgcc
gcgcagctggcggcgctggctgggtcaacggccgcggagcccctcgacgtgctggtggtc
ggcggcggcgccaccggctgtggcgttgcgcttgacgcggccacccgtggcctccgcgtt
ggcctggtcgagcgggaggacttctcctcgggcacctcgtcccgatccaccaaactcatc
catgggggtgtgcgctacttggagaaggcagtgtttaatcttgattatgggcagctcaaa
cttgtttttcatgctcttaaggaacgcaagcaagttattgagaatgctcctcacttatgc
catgctttgccgtgcatgactccttgctttaactggtttgaggttgtatactattggttt
ggtttgaagttctatgatatagttgctggaagaaggttgctacatttatctcggtattat
tctgtagaagaatcagttgaacttttcccgacccttgcaaggaatgatggtgatcgtagc
ctaagaggaacagtagtatactatgatggtcaaatgaatgactctcgtttgaatgtgggg
ttggcatgcacatctgcagttgttggtgcagctattctcaattatgctgaagtaatctcc
ctcattaaggatgaatctggagagaggatcattggtgcacacatccgtgacgcgctatca
ggtaaggaatttgacacatttgcaaaggtggttgtcaatgcatcaggagcattctgtgac
aatgtgaggaagatggctaacagtgatgtagtacccatgatctgtccaagcagtggggtg
cacattgtacttccagattattattcccctgaagggatggggttaattgtccccaaaacc
aaagatggtagggttgtatttatgctgccatggttgggaaggacgattgccgggacaact
gattctagtacagcaataacaatgcttcctgaaccacatgaggatgaaatacagtttata
ttagatgcaatctgtgattatcttaacgttcaggtgaggcgttcagatgttctttctgcc
tggagtggtatacgcccattggccatggatccttcagcaaagaacacagaaagtatttct
agagatcatgttgtatttgaagactacccagggctaataacaatcacgggtggaaaatgg
acaacttatagaagcatggctgaagacgctgttaatgcagccatacggtcagggaatttg
aagccagctaatgactgtgttactgatcatttgcatattgctggtggatacggatgggac
cctgcttcttttactgtgcttgctcagaatttcaagcgaatgaaaaagacatatggtggc
aaagttatcccaggtgcaatggacagtgctgtatcaaaacatctgtcacatgcatatgga
actttggctgaacaagtggctgcaattgcccagaacgaaggattgggaaagcgactggct
catggatacccatttttagaagctgaagtggcatattgtgctcgtcatgagtactgtgaa
tctgctgtcgactttgtggcaaggagatgtcggcttgcctttcttgacacagatgctgca
gggagagcactgcccaggatcattgagattttagcttcggaacacaagtgggacaaggca
agacggaagcttgaactccagaagggtatagagttcttggaaaccttcaagtcatcaaag
aatgcacagttcagggatggaaaacataacgggcaatga

DBGET integrated database retrieval system