KEGG   Brachypodium distachyon: 100838090Help
Entry
100838090         CDS       T01717                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00051  Fructose and mannose metabolism
bdi00052  Galactose metabolism
bdi00500  Starch and sucrose metabolism
bdi00520  Amino sugar and nucleotide sugar metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
Module
bdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bdi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100838090
   00051 Fructose and mannose metabolism
    100838090
   00052 Galactose metabolism
    100838090
   00500 Starch and sucrose metabolism
    100838090
   00520 Amino sugar and nucleotide sugar metabolism
    100838090
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100838090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bdi04131]
    100838090
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100838090
Membrane trafficking [BR:bdi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100838090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 YmgD
Motif
Other DBs
NCBI-GeneID: 100838090
NCBI-ProteinID: XP_003568034
UniProt: I1HH95
LinkDB All DBs
Position
2
AA seq 494 aa AA seqDB search
MRKAAAAAVAAAVAVGAALLVRRQIREAKRWARAAAVLRELEERCAATPARLRQVADAVA
VEMHAGLASEGGSKLGMIISHVESLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVK
QECEEISIPTNLMTGNSHDLFDFIAAALAKFVASEGEDFHLPEGRQRELGFTFSFPVKQS
SISSGTLIKWTKGFAINDTVGEDVVAELSRALDRQGLDMKVTALVNDTIGTLAGGRYDDN
DVVVAVILGTGTNAAYVERANAIPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEFDQALD
AESLNPGEQIYEKLISGMYLGEIVRRILLKMTQEASLFGDDIPPKLKIPYILTTPHMSMM
HHDGSSDLRTVGAQLRDILGIQNTSLKTRRLVVAVCDIVAKRGSRLAAAGIHGILKKLGR
DIPSSDKQRTVIAMDGGLYEHYTIFSESLESTLQEILGEEVSSSVVIKLANDGSGIGAAL
LAAAHSQYLDAEEQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcggcggctgcggcggtcgcggcggcggtggccgtgggggcggcgctgctg
gtgcgccgccagattcgcgaggcgaagcggtgggcgcgcgcggcggcggtgctgcgggag
ctggaggagcggtgcgcggcgacccccgcgcggctgcgccaggtggcggacgccgtggcc
gtggagatgcacgccgggctcgcctccgagggcgggagcaagctcgggatgatcatcagc
cacgtcgagtccctcccgtcagggcaagagaaggggctattttacgcacttgaccttgga
gggacaaatttccgtgttttacgtgttcaattaggaggaaaggaagggcgagttgtcaag
caagaatgcgaagagatttcaattccgacaaacttaatgacagggaattcacatgaccta
tttgactttatcgccgctgctttggcaaaatttgttgcctcagagggtgaagactttcat
ttgcccgagggaaggcaaagagaacttggttttactttctcttttccagtaaagcaatct
tcaatttcatctggtactcttatcaagtggactaagggttttgctattaatgacacggta
ggcgaggatgtcgtggctgaattaagcagggctctggaccgtcagggtctcgatatgaaa
gtcacagcactggtaaatgatactatagggacattggctggcgggagatatgatgacaat
gatgttgttgttgctgttatactgggtacaggtactaatgcagcatatgtggaacgtgcc
aatgcaattcctaaatggcatggcctcctgcccaagtcaggagatatggtaataaatatg
gaatgggggaactttaggtcatcccatcttcctttgactgaatttgatcaagcattagat
gccgaaagcctgaatcctggagaacagatttatgagaagctgatctctggtatgtatttg
ggggaaattgtaagaagaatcctgttaaagatgactcaagaagcttctctttttggtgat
gatataccaccaaaactaaagattccatacattcttacgacaccgcatatgtcaatgatg
catcatgacggatcatctgatctcagaacagttggagcccaactgagagatatcctaggg
atccaaaacacctcacttaaaacaagaagactagttgtggctgtatgcgatatcgttgca
aagcgtgggtcacgtctcgctgctgcagggatacacgggatcctcaaaaagcttggacgg
gatatccccagcagcgacaagcaaaggacggtgattgccatggacggtgggctctacgag
cactacacgatcttcagcgagtccctggagagcaccctgcaggagattctaggggaggaa
gtttcgtcctctgtcgtgatcaagcttgcgaatgacgggtcaggtattggggctgctctc
ctcgctgcggctcattctcagtaccttgatgctgaagagcaatag

DBGET integrated database retrieval system