KEGG   Brachypodium distachyon: 100840092Help
Entry
100840092         CDS       T01717                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 4A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100840092
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100840092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100840092
NCBI-ProteinID: XP_003562484
UniProt: I1GRB8
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MVKAVAVLSGSEGVKGTIFFTQEGDGPTTVTGSVSGLKEGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDETRHAGDLGNVTAGVDGVANINVVDTQIPLTGPHSIIGRAVVVHG
DPDDLGKGGHELSKSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtgctttccggcagcgagggtgtcaagggcaccatctttttc
acccaagagggagatggtccgaccaccgtgacaggaagtgtctctggactcaaggaaggg
ctccacgggttccatgtgcacgctcttggtgacaccaccaatggctgcatgtcaactgga
ccacactttaaccccgctggtaaggagcatggcgcaccagaagatgaaactcgccatgct
ggtgatcttggaaatgtgacggctggagtggatggtgttgctaacatcaatgttgttgac
acccagatccccctgactggaccgcattcgatcattggccgtgctgttgttgtccatggt
gatcctgatgatcttggcaagggtggacatgagcttagcaagagcactgggaatgctggt
gcacgtgttgcttgtgggatcatcgggctccagggctag

DBGET integrated database retrieval system