KEGG   Brachypodium distachyon: 100843366Help
Entry
100843366         CDS       T01717                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bdi  Brachypodium distachyon
Pathway
bdi03030  DNA replication
bdi03410  Base excision repair
bdi03420  Nucleotide excision repair
bdi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100843366
   03410 Base excision repair
    100843366
   03420 Nucleotide excision repair
    100843366
   03430 Mismatch repair
    100843366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bdi03032]
    100843366
   03400 DNA repair and recombination proteins [BR:bdi03400]
    100843366
Enzymes [BR:bdi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100843366
    6.5.1.6  DNA ligase (ATP or NAD+)
     100843366
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100843366
DNA replication proteins [BR:bdi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100843366
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100843366
DNA repair and recombination proteins [BR:bdi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100843366
   NER (nucleotide excision repair)
    Other NER factors
     100843366
   MMR (mismatch excision repair)
    Other MMR factors
     100843366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Presenilin DNA_ligase_OB_2 TrmB
Motif
Other DBs
NCBI-GeneID: 100843366
NCBI-ProteinID: XP_003571920
UniProt: A0A0Q3HUL9
LinkDB All DBs
Position
3
AA seq 918 aa AA seqDB search
MFLLRATATTPLHLLRCHPLPSPKTLATTLAHPPPLLLRPRLYSSASPRRRSITATPSVA
KSSEKKPPARPKRAEAVLPLAAANAGAEAMSSSGGAGGKRSVADVLMGNARDAARKAKKG
AAGASGAAPSPKKPRAKTTAQGDDAAVEQAVAEKPPSPAKSKRPLSPAKAKSQAETSPAE
KKRSPSPTRSKKLAAAPKLEAEEKPPSPKRLKTLAAKSDAKLSDDALLSQSDEKQKRTSP
SPTKAKGQASQSEDKTRPSSPKKSKTSNATKSEERNTTFELKKKGSEFDPMAAAYWKPTE
PVPFLFLAQALDLISNESGRIVITEILSNVFRTIIATTPEDLLATVYLSANRIAPPHEGI
ELGIGDASIIRALAEAYGRKEEHVKKNLKELGDLGLVAKASRLSQKMMYKPKPLTIARVL
DTFRTIAKESGKDSQDKKRSHIKGLLVAATDCEPQYIIRLLQSKMRIGLAEKTVQMALGQ
AAVYSEEGSPPAKVQSPFEEAAKIIKQAYSVLPIYDRIVPTLLEAGVWKLPETCNFSIGV
PVGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCMEDGSVEIYSRNAERNTGKY
PDVVDAVSRFRKPAVKSFVLDCEIVAYDREKKKILPFQILSTRARKGVTINDIKVSVCTF
GFDILYINGKPLLQEQLKVRREHLYNSFEEVPGIFQLATAITSNDLEEIQKFLDVAVNSS
CEGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSVGDSLDLVPIAAFHGRGKRTGVYGSF
LLACYDEQNEEYQTICNIGTGFSEQQLEERSTSLRSKVISKPKAYYRFADTTDPDVWFEP
SEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLRVRDDKNPEHATTSEQVADMYR
AQKINHSHNQDDEDDDRD
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgttcctccttcgagccaccgccaccaccccgctccacctgctccgatgccacccgctc
ccctcgcctaaaaccctagccaccacgctcgcacacccgcccccgctcctcctccgcccc
cgcctatactcgtcggcctccccccgccgccgctcaatcaccgccaccccctctgtcgcc
aaatccagcgagaagaagccgcccgcgagaccgaagagggcggaggctgtgctgccacta
gccgcggccaacgcgggagcggaagccatgtcgtcctcgggcggcgccggggggaagcgc
tccgtggcggatgtgctcatggggaacgcgcgggacgccgccaggaaggcgaagaagggg
gccgcgggcgcctccggggcggcgccgtccccgaagaagcccagggcgaagaccaccgcc
cagggcgacgacgcggctgtcgagcaggcggtggcggagaagccgccttcgccggcgaag
tcaaagcgcccgttgtccccagctaaggccaagtcccaggctgagacctcgcctgccgag
aagaagaggtcgccgtcgcccacgaggtccaaaaagctagccgcggcccctaaattggag
gccgaggagaagcccccttcaccaaagaggttgaaaaccctagcggctaaatctgacgcc
aagctctctgacgacgcccttctctcgcagtctgacgagaagcaaaagaggacatcccca
tcgccgaccaaggctaaaggccaagcgtcccaatccgaagataagacgaggccctcatca
ccgaagaagagcaaaacctcaaatgccaccaagtccgaggagaggaataccacttttgag
ctcaagaagaaaggcagtgaatttgatcccatggctgctgcctattggaagcccactgag
cctgtgcccttcctgttcctggctcaggcgcttgatctcatctccaacgagtctggccgg
attgtcattacagagatcctgtcgaatgtgttccggacgattattgccaccacaccagaa
gatctccttgcgacagtatacctctcagccaaccggattgcgccaccccatgaggggatt
gagcttggaattggggacgcatcaatcattcgtgcacttgctgaagcatatggtcgcaaa
gaggagcatgtcaagaagaacctcaaggaattgggagatttggggcttgtggcgaaagca
agcaggttgtcacagaagatgatgtacaagccaaaaccactgacaatagcacgtgtgctt
gatacctttcggacaattgccaaggagtccggcaaagatagtcaagataagaaaagaagt
catatcaaaggacttcttgttgctgcaacagactgtgaacctcaatatattatacgcctt
cttcagtcaaagatgcgtattggcttggcagagaaaactgtccaaatggctcttgggcaa
gctgctgtatattctgaagaaggatccccgccagcaaaagttcaatcaccctttgaagag
gccgcaaaaataattaaacaagcatattcagttcttcctatctatgatagaattgtaccg
actcttcttgaagccggtgtctggaaacttccagaaacatgcaatttctccataggtgtc
cctgttggccctatgttggcaaaagcaacaaaatctgtttcagagatcatcgacaagttc
caaggacttgagtacacttgtgagtacaagtatgacggtgaacgggcccagattcattgc
atggaggatggatcagtagagatttatagtcggaatgctgaacggaacactgggaagtat
cctgatgttgttgatgctgtttctagattccgaaagcctgcagtcaagtcatttgtgttg
gactgcgaaattgttgcttatgaccgtgaaaagaagaaaattttaccttttcagatactt
agcacaagggcccgcaagggtgttaccataaatgacatcaaagtgtcagtctgtactttt
ggctttgatattctttacatcaatgggaaacctcttctccaggaacaactcaaagttcgt
cgagagcatctttacaactctttcgaggaagtacccggtatttttcagttggcaactgca
attacatcaaatgacctcgaggagatacaaaaatttcttgatgtagctgtcaactccagt
tgtgaagggttgattatcaagacattggataaggatgctacatatgagccagcaaagcgg
tcaaacaattggttgaaattgaagaaagactacatggacagtgttggagactctttagac
ttggtgccaattgctgcttttcatggaagaggaaaacgaacaggtgtatatggatcattc
ctcttggcatgctatgatgagcagaatgaagaataccaaacaatctgcaatataggtact
gggttttctgaacaacaacttgaagaacgatctacgagccttcgaagtaaagtaatatcg
aaaccaaaggcatactataggttcgctgacacaactgacccagatgtgtggtttgaaccg
tcagaggtttgggaggtcaaagctgctgatttgagcataagtcctgttcatcgtgcggct
aatggtatagttgatccgaataagggtatctctctaagatttccacgtctgttgcgagtc
cgcgatgataaaaacccagaacatgcaaccacatctgagcaagttgctgacatgtaccgt
gctcaaaaaataaaccactcgcataaccaagatgatgaggatgatgaccgagactga

DBGET integrated database retrieval system