KEGG   Brachypodium distachyon: 100845336Help
Entry
100845336         CDS       T01717                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00620  Pyruvate metabolism
bdi00710  Carbon fixation in photosynthetic organisms
bdi01100  Metabolic pathways
bdi01200  Carbon metabolism
Module
bdi_M00168  CAM (Crassulacean acid metabolism), dark
bdi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
bdi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
bdi_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100845336
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100845336
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     100845336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 100845336
NCBI-ProteinID: XP_003577980
UniProt: I1IPB7
LinkDB All DBs
Position
4
AA seq 968 aa AA seqDB search
MASSAPGKIERLSSIDAQLRMLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMV
QECYEVAAEYETKHDLQKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRR
RIKLKKGDFAEENSAITESDIEETLKRLVVDMKKSPAEVFDALKNQTVDLVLTAHPTQSV
RRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMR
AGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE
VTRDVCLLARMMAANLYCAQIEDLMFELSMWRCNDELRSRADELHRSSKKDAKHYIEFWK
KVPPNEPYRVILSDVRDDLYNTRERSRELLSSGHSDIPEEATLTNLEQLLEPLELCYRSL
CACGDRVIADGTLLDFLRQVSTFGLSLVKLDIRQESDRHTDVLDAITTYLEIGSYREWSE
ERRQEWLLSELNGKRPLFGADLPKTEEVADVLDTFHVIAELPADNFGAYVISMATAPSDV
LAVELLQRECHVKTPLRVVPLFEKLADLEAAPAALARLFSIDWYRGRINGKQEVMIGYSD
SGKDAGRLSAAWQMYKAQEDLVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
INGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALLDEMAVV
ATKEYRSIVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFKHILQKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNPGIAAL
YDRLLVSEELHPLGEKLRVNYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYITTMNV
CQAYTLKRIRDPDYHVALRPHLSKEVMDTSKPAAELVTLNPASEYAPGLEDTLILTMKGV
AAGLQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcggcgccggggaagatagagcggctgtcgtcgatcgacgcgcagctgcgg
atgctggtgccggccaaggtgtcggaggacgacaagctcatcgagtacgatgccctcctc
ctcgaccgcttcctcgacgtcctgcagggcctacacggcgacgacctcagggagatggtt
caagaatgctatgaggtggctgctgaatatgaaacaaagcatgacttgcaaaagcttgat
gaacttggggagatgataacaagcttggatcctggtgactcaattgtgattgccaaagct
ttttcacacatgcttaacttggccaacttggctgaggaagtacagattgcatataggagg
agaattaagctcaagaagggagattttgctgaagagaactcagcaatcaccgaatctgac
atcgaggaaacccttaagagacttgttgttgacatgaagaagtcccctgctgaggtcttt
gatgcgctcaagaatcagactgtcgatctggttttgactgcacatccaacacagtctgta
aggaggtcactgctccagaaacattcaaggattcggaactgtttggttcagctatactca
aaggatattactccggatgacaagcaggagcttgatgaggctctccaaagagagattcaa
gctgccttcagaactgatgagattcgaaggactcagccgactccccaagatgaaatgcgt
gctggtatgagctacttccatgaaaccatatggaagggtgttccgaagttcttgcggcgt
gttgatactgcattgaagaacattgggatcaatgagcgtgttccttataatgctcctctt
atccagttctcttcttggatgggaggagatcgtgatggaaatccaagagttacaccagag
gttacaagggatgtctgcttgcttgcaagaatgatggcagcaaatttgtattgtgcacaa
attgaggatctcatgtttgagttgtctatgtggcgatgcaatgatgagctacgttcacga
gctgatgagctgcatcgctcttctaagaaggacgcgaaacattacatagagttctggaag
aaggttcccccaaatgagccataccgggtaatactgagtgatgtcagggatgatctttac
aacacccgtgagcgttcacgagagttgttatccagtggacattctgacattcctgaggaa
gctactttgacaaatcttgagcagctactggaacccttagagctatgttacaggtcgctt
tgtgcttgtggtgatcgtgttattgctgatggaacccttcttgatttcttgcgccaagtc
tctacctttgggctctcccttgtgaagcttgacataaggcaagagtctgacaggcacact
gatgtccttgatgccatcacaacgtacctggagataggatcttaccgtgagtggtctgag
gaacgtcgtcaagaatggttgttgtccgaactcaacggaaagcgcccattatttggtgca
gaccttcccaagacagaggaagttgctgatgttcttgacacgttccatgttatcgctgag
ctgcctgctgacaactttggagcatacgtcatttccatggcaactgccccttcagatgtc
cttgctgtggagctcctccaacgtgagtgccatgtgaagacaccacttagagttgtaccc
ctatttgagaagttggccgatcttgaggctgccccagcagcattggccagactcttctca
atagattggtacagagggaggatcaatggcaagcaggaggtaatgatagggtattcagac
tcaggtaaggatgctggccgtttatcagcagcttggcagatgtacaaagctcaggaagat
ctcgtcaaggttgctaagcaatttggtgtgaagttaacaatgttccatggacgaggtggg
actgttggaaggggtggtggccctactcacctggccatcttgtctcaaccaccagacaca
atcaatgggtcactccgtgtcactgttcaaggtgaagttattgagcagagctttggtgag
gaacacttgtgcttcaggacgcttcagcgtttcacagctgctacacttgagcatggtatg
cgtccacccatttcaccaaagccagagtggagagctcttcttgatgagatggctgtggtg
gcaacgaaggaatatcggtcaattgtcttccaagaaccacgtttcgtcgagtatttccgc
cttgcaacaccagagacagagtatggcaggatgaatataggaagcaggccatctaagaga
aagccaagtggtggcatcgaatcactccgtgcaataccatggatctttgcatggacgcaa
acgcggttccacctccccgtctggctgggctttggtgctgcattcaagcatattctccag
aaggacatcaggaatttccacatgctccaggagatgtacaacgagtggccatttttcagg
gtcactattgatctagttgagatggtgtttgccaagggtaatcctggcattgctgccttg
tatgacagactcctggtttcagaggaactacatccattgggtgagaagctgagggtcaat
tatgaagaaacccaaaagcttcttcttcaggttgctgggcacaaggatcttcttgaaggt
gatccctacctgaagcagcggctccgccttcgtgacgcatacattaccaccatgaatgtc
tgccaagcctacacacttaagcggatccgcgacccagattaccatgttgcattgcgcccc
catctgtccaaggaggtcatggacacaagcaaaccagctgctgagcttgtgacgttgaac
ccggcgagcgagtatgccccggggctggaggacaccctcatcttgaccatgaaaggcgtt
gctgccggtttgcagaacaccggttag

DBGET integrated database retrieval system