KEGG   Brachypodium distachyon: 100845943Help
Entry
100845943         CDS       T01717                                 

Definition
(RefSeq) alpha-amylase isozyme 3A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00500  Starch and sucrose metabolism
bdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100845943
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100845943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 100845943
NCBI-ProteinID: XP_003578230
UniProt: I1IQR0
LinkDB All DBs
Position
4
AA seq 439 aa AA seqDB search
MGKQVTALNGLLVAMALLCLSCDALAQTQILFQGFNWESCNKQGGWYNMLKGRVGSIASS
GVTHVWLPPPSHSVSPQGYMPGRLYDVDASKYGTKAELKSLIAAFHGKGVKCVADIVINH
RTAEEKDGRGVYCIFKGGGGPEGQLDWGPGMICSDDAKYSDGTGHRDTGADFAAAPDIDH
LNPRVQRELSAWLGWLKSDLGFDGWRLDFAKGYSAEVAKVYAGNASPGFVVAEIWNSLSY
DGDGKPATNQDGERQELVNWAKAVGGPAMAFDFTTKGILQAAVQGELWRMRGKDGKAPGM
IGLSPEKAVTFVDNHDTGSTQKMWPFPADKVMMGYAYILTHPGLPCIFYDHVFDWNLKKE
IDTLAAVRSRNGINAGSKLRILAAESDVYVAMVDEKVISKIGPRFDAGNLIPSDFHVVAH
GSNYCVWEKSGLRVPAGRR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcaagtcaccgccctgaatgggctccttgttgcaatggcattgctctgtctc
tcgtgtgacgcgcttgcacagacacagatcctcttccaggggtttaattgggagtcgtgc
aacaagcaggggggctggtacaacatgctcaagggccgggtgggcagcatcgccagctcc
ggggtcacacacgtctggctgcccccaccctcgcactctgtttcgcctcaaggctacatg
ccgggccggctctacgacgtggacgcgtccaagtacggcacgaaagcggagctcaagtcg
ctgatcgccgccttccacggcaagggcgtcaaatgcgtcgccgacatcgtcatcaaccac
cgcaccgccgaggagaaggacggccgcggcgtgtactgcatcttcaagggcggaggaggg
cccgagggccagctggactgggggcccggcatgatctgcagcgacgacgccaagtactcg
gacggcacgggccaccgcgacacgggcgccgacttcgccgccgcccccgacatcgaccac
ctcaacccacgtgtccagcgggagctctccgcctggctcggctggctcaagtccgacctc
ggcttcgacggctggcgcctcgacttcgccaagggctactcggcggaggtcgccaaggtg
tacgccggcaacgcgagccccgggttcgtcgtcgcggagatatggaactcactgagctac
gacggcgacgggaagcccgcgactaaccaggacggcgagcggcaggagctggtgaactgg
gcgaaggcggtgggcggcccggcgatggcgttcgacttcacgaccaagggcatcctgcag
gcggcggtgcagggcgagctgtggcggatgcggggcaaggacggcaaggctcccgggatg
atcgggctgtcgccggagaaggccgtcacgttcgtggataaccacgatacgggctccacg
cagaagatgtggccgttcccggccgacaaggtcatgatgggctacgcgtacatcctcacc
caccctgggcttccatgcatcttctacgatcacgtgttcgactggaacctgaagaaagag
atcgacacgctggcggcggtgaggagtcgcaacgggatcaacgcgggtagtaagctgcgc
atcctggcggccgagagcgacgtctacgtggcgatggtcgacgagaaagttatctccaag
attggaccgaggttcgacgccggtaacctgatcccgtcggacttccacgtggtggctcac
ggcagtaactactgcgtctgggagaagagcggccttcgagtcccagccggacggcgctag

DBGET integrated database retrieval system