KEGG   Brachypodium distachyon: 6439897Help
Entry
6439897           CDS       T01717                                 

Gene name
rbcL, BrdiC_p033
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00630  Glyoxylate and dicarboxylate metabolism
bdi00710  Carbon fixation in photosynthetic organisms
bdi01100  Metabolic pathways
bdi01200  Carbon metabolism
Module
bdi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bdi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bdi_M00532  Photorespiration
bdi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    6439897 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    6439897 (rbcL)
Enzymes [BR:bdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     6439897 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 6439897
NCBI-ProteinID: YP_002000495
UniProt: B3TN59 A0A0Q3NL75
LinkDB All DBs
Position
CP
AA seq 476 aa AA seqDB search
MSPQTETKASVGFKAGVKDYRLTYYTPEYETKDTDILAAFRVSPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEDSQWICYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRAACKWSPELAAACEVWKAIKFEFAPVDTID
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaagattat
agattgacttactacaccccggagtatgaaaccaaggatactgatatcttggcagcattc
cgagtatctcctcaacctggggttccgcccgaagaagcaggggctgcagtagctgccgaa
tcttctactggtacatggacaactgtttggactgatggacttactagtcttgatcgttac
aaaggacgatgctatcacatcgagcctgttcctggggaagacagtcaatggatctgttat
gtagcttatccattagatctatttgaagagggttccgttactaacatgtttacttccatt
gtaggtaacgtatttggtttcaaagccctacgtgctctacgtctggaggatctacgaatt
ccccctacttattcaaaaactttccaaggcccgcctcacggtatccaagtggaaagagat
aagttgaacaagtatggtcgtcctttattgggatgtactattaagccaaaattgggatta
tctgcaaaaaattacggtagagcgtgttatgagtgtctacgtggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgctggagagatcgttttgtcttt
tgtgccgaagctatttataaatcacaggcggaaaccggtgaaatcaaggggcattacttg
aatgcaactgcgggtacatgtgaagaaatgatgaagagagctgtttttgcgagagaatta
ggtgttcctattgtaatgcatgactacttaactgggggattcaccgcaaatactactttg
gctcattattgccgcgacaatggcttacttcttcacattcaccgtgcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tctgggggagatcatatccacgccggtacagtagtaggtaagttagaaggggaacgcgaa
atcactttaggttttgttgatttattgcgcgacgattttattgaaaaagatcgtgctcgc
ggtatctttttcactcaggactgggtatccatgccaggtgttataccagtagcttcaggt
ggtattcatgtttggcatatgccagctctgaccgaaatctttggggatgattctgtatta
caatttggtggaggaactttaggacatccttggggaaatgcacctggtgcagcagctaat
cgagtggctttagaagcctgtgtacaagctcgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatccgagcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
gtatggaaggcgatcaaattcgagttcgcgccggtagatactatcgattaa

DBGET integrated database retrieval system