KEGG   Burkholderia dolosa: AK34_2581Help
Entry
AK34_2581         CDS       T03793                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00473  D-Alanine metabolism
bdl00550  Peptidoglycan biosynthesis
bdl01100  Metabolic pathways
bdl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AK34_2581
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AK34_2581
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AK34_2581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdl01011]
    AK34_2581
Enzymes [BR:bdl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AK34_2581
Peptidoglycan biosynthesis and degradation proteins [BR:bdl01011]
 Precursor biosynthesis
  Amino acid ligase
   AK34_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_4 ATPgrasp_YheCD TTL PPR
Motif
Other DBs
NCBI-ProteinID: AJY12565
UniProt: A2WCX6
LinkDB All DBs
Position
1:complement(2771208..2772149)
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPP
FETVMRGDDYAARATEIVAKLGLPLFVKPASEGSSVAVLKVKTADALPAALSEAATHDKI
VIVEKSIEGGGEYTACIAGDLDLPLIKIVPAGEFYDYHAKYVANDTQYLIPCGLPADKEA
ELKRIARRAFDVLGCTDWGRADFMLDAQGNAYFLEVNTAPGMTDHSLPPKAARAIGIGYS
ELVVKVLSLTLND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgttgttcggcggcgagtcc
gccgagcgcgaggtgtcgctcacctcgggccgcctcgtgctgcagggcctgcgcgacgcg
ggcgtcgacgcgcatccgttcgacccggccgagcggccgctgtccgcgctgaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacgggatccgctatacgggcagcggcgtgctcggttcggcgctc
gggctcgacaagttccgcacgaagctcgtgtggcagcagaccggcgtgccgacgccgccg
ttcgagacggtgatgcgcggcgacgactacgcggcgcgtgcgacggagatcgtcgcgaag
ctcggcctgccgctgttcgtgaagccggcgagcgaaggctcgagcgtcgcggtgctgaag
gtgaagacggccgacgcgttgccggccgcgctgtcggaagcggcgacgcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacacagcgtgcatcgccggcgat
ctcgacctgccgctgatcaagatcgtgccggccggcgagttctacgactatcacgcgaag
tacgtcgcgaacgacacgcagtacctgattccgtgcgggctgccggccgacaaggaagcg
gagctgaagcgcatcgcgcggcgcgcgttcgacgtgctcggctgcaccgactggggccgt
gcggacttcatgctcgatgcgcaaggcaacgcgtatttccttgaagtgaacacggccccc
gggatgaccgaccactcgctgccgccgaaagcggcgcgcgcgatcggcatcggctattcg
gaactggtcgtgaaggtgctgtcgctcacgctcaacgactga

DBGET integrated database retrieval system