KEGG   Burkholderia dolosa: AK34_3133Help
Entry
AK34_3133         CDS       T03793                                 

Definition
(GenBank) sel1 repeat family protein
Organism
bdl  Burkholderia dolosa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sel1
Motif
Other DBs
NCBI-ProteinID: AJY14591
UniProt: A0A0D5J5W7
LinkDB All DBs
Position
1:3363612..3364382
Genome map
AA seq 256 aa AA seqDB search
MNDDDADCLYAARASGAFARIGIACGLWAACVAAAAAQGAPRAKPDPAHETQSAVADYNA
GDYRAALVQFHDAAERGDRLAQFNYAMMLLTGVGVTANVDEGLRWLKRAADANMSHAQYV
YGRMFDDGEFVARNPVEAHRWFLRAAKQGHVQAALSLANQFLDGRGTRRDNRQAFVWYKQ
AADAGEPTAQYVTASFYERGGDGVAQNLNIARAYYAAAAAQGDETAELKFKELSARLQAP
ASGTAAERAAPRTAPQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacgatgcggattgcctatatgccgcccgtgcgagcggcgcgttcgcgcgg
atcggcatcgcgtgcggcttgtgggccgcgtgcgtggccgcggccgccgcgcagggcgcg
ccgcgcgcgaagcccgatcccgcgcacgagacgcagtcggccgtcgccgactacaacgcc
ggcgactatcgcgcggcgctcgtgcagttccacgacgccgcggagcgcggcgaccggctc
gcgcagttcaactacgcgatgatgctgctgaccggcgtcggcgtgaccgcgaacgtcgac
gaagggttgcgctggctgaagcgcgcggccgacgcgaacatgtcgcatgcgcagtacgtg
tacgggcggatgttcgacgacggcgagttcgtcgcgcgcaatccggtcgaagcgcatcgc
tggttcctgcgcgcggcgaagcaggggcacgtgcaggccgcgctgtcgctcgcgaaccag
ttcctcgacggccgcggcacgcggcgcgacaaccggcaggcgttcgtctggtacaagcag
gcggccgatgcgggagagccgaccgcgcagtacgtgacggcgtcgttctacgagcgcggc
ggcgacggcgtcgcgcagaacctgaacatcgcccgcgcgtattacgcggccgcggccgcg
cagggcgacgaaacggccgagctgaaattcaaggagctgagcgcgcggctgcaggcgccg
gcgtcgggcaccgcagcggagcgggccgcgccgcgcacggcgccgcagtga

DBGET integrated database retrieval system