KEGG   Burkholderia dolosa: AK34_3158
Entry
AK34_3158         CDS       T03793                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bdl  Burkholderia dolosa
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bdl02044]
    AK34_3158
Secretion system [BR:bdl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AK34_3158
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AJY12671
UniProt: A0A0D5J0H0
LinkDB
Position
1:3394263..3395762
AA seq 499 aa
MAVRESQARVADAQLGIESDFNALLSREFKPKTEQAREAVEAAVKTLAEQALANSATMSD
DAYKSIAAIIGEIDRKLSEQINLILHHEDFQKLESAWRGLHHLVTNTETDEKLKIRFMDV
SKEDLRRTMKRYKGVAWDQSPFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLAS
IGKVAAAAHAPFITGASPSVLQMDSWQELANPRDLTKIFTQNLEYAPWNSLRNSEDARYI
GLAMPRFLARLPYGVRTNPVDEFDFEEATDGSDHRKYTWANAAYAMAVNINRSFKHYGWC
TLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELSKNGFIPLIHRKNTD
YAAFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDE
MQQWLNEWIMYYVDADPANSSQETKARRPLAAAEVVVEEVEGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSVKAAA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggctgtacgtgaatcgcaggcgcgcgttgcggacgcgcagctcggcatcgaatcggat
ttcaacgcgttgctgtcgcgcgagttcaaacccaagacggagcaggcacgcgaagcggtg
gaagccgccgtgaagacgctcgccgagcaggcgctggccaattcggcgacgatgtcggac
gacgcctacaagagcatcgcggcgatcatcggcgagatcgatcgcaagctgtcggagcag
atcaatctgattctgcatcacgaggatttccagaagctggaaagcgcatggcgcgggttg
caccatctggtcacgaacacggaaaccgacgagaagctgaagatccgcttcatggacgtg
tcgaaggaggatctgcgccgcacgatgaagcgctacaagggcgtcgcgtgggatcagagt
ccgttcttcaagcagatttacgaagaggaatacggtcagctgggcggcgagccgtacggc
tgcctggtcgccgactactacttcgatcacacgccgccggacgtcgatctgcttgcatcg
atcggcaaggtcgcggccgccgcgcatgcgccgttcatcaccggcgcgtcgccgtccgtg
ctgcagatggattcgtggcaagagctggcgaaccctcgggatctgaccaagatcttcacg
cagaacctcgagtatgcgccgtggaactcgctgcgcaactcggaggatgcgcgctacatc
ggtctagcgatgccgcgctttctcgcacggttgccgtacggcgtccgcaccaacccggtc
gacgagttcgatttcgaggaggcgaccgacggatccgatcaccgcaagtacacgtgggcg
aacgctgcgtatgcaatggccgtcaacatcaatcgctcgttcaagcactatggctggtgc
acgctgatccgcggcgtcgagagcggcggcgtcgtcgaaaacctcccgtgccatacgttc
ccgaccgacgacggcggcatcgacatgaaatgtccgaccgagatcgcgatttcggaccga
cgcgaggccgagctgtcgaagaacggcttcattccgctgatccatcggaagaacaccgac
tacgcggcgttcatcggcgcgcagtcgctgcaaaagcccgccgaataccacgatccggac
gcgacggcgaacgcgaatctttccgcgcgtctgccgtatctgtttgcgtgctcgcgcttc
gcgcactacctgaaatgcatcgtgcgcgacaagatcggctcgttcaaggagcgcgacgaa
atgcagcaatggctcaacgaatggatcatgtactacgtcgacgccgatcctgcgaactcg
tcccaggaaaccaaggcgcgtcgtccgcttgccgctgccgaggtggtcgtcgaagaagtc
gaaggcaatcccggctactaccaagcgaagttcttcctgcgtccgcatttccagctggaa
ggtctgaccgtgtcgttgcggctcgttgcgaagctgccgtcggtcaaggccgccgcgtga

DBGET integrated database retrieval system