KEGG   Burkholderia dolosa: AK34_4230
Entry
AK34_4230         CDS       T03793                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00440  Phosphonate and phosphinate metabolism
bdl00998  Biosynthesis of various secondary metabolites - part 2
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AK34_4230 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    AK34_4230 (aepX)
Enzymes [BR:bdl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AK34_4230 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AJY10003
UniProt: A0A0D5IU74
LinkDB
Position
2:1242620..1244308
AA seq 562 aa
MNAREPNFTESRSARLRRMLVSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPSNQSVRDFAFCSAADDRGLFGHKVLLERVSSDAAERTPHGRWIGLLNV
RGAGVERLKAMLATLQARDDFDTLDIPALLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaacccaatttcaccgaatcgcgcagcgcacgcctgcgccggatgctc
gtcagcaacgaactcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaaggggatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaggccagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgcggagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgacccggacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgt
cccgacgaaatcctgcagttcgcgcgcgaatggagcggcaaggcaccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcatcggcgtccgcgatgcaggccgtcgcgcgcgag
atccacgaaagcgaaacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccggctgcaggacgccgacgaatattcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaagacaagccgaaggtgatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcacggtcgtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtgaacgagcgccacgcggaaaca
ggcgaactcgcatcgctcgcgtgcgcggccgagcgcctgaccggcgacacggtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgtcgaaccagagcgtgcgcgacttc
gcgttctgctcggctgccgacgatcgcgggctgttcggccacaaggtgctgctcgaacgc
gtgtcgagcgatgccgcagaacgcacgccgcacggccgctggatcgggctgctgaacgtg
cgcggcgcgggcgtcgaacgcctgaaggcgatgctcgcgacgctgcaggcgcgcgacgat
ttcgacacgctcgacatccccgcgctgctgaacgaactgatcgccgccggcgagaagatc
gaagtgcagtacgtgcacggccactggcgcggcgtgaacgatctcgaggacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system