KEGG   Burkholderia dolosa: AK34_4267Help
Entry
AK34_4267         CDS       T03793                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdl  Burkholderia dolosa
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AK34_4267 (ahpF)
Enzymes [BR:bdl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AK34_4267 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_binding_3 Glutaredoxin Thi4 K_oxygenase AlaDh_PNT_C FAD_oxidored NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AJY10917
UniProt: A0A0D5IVE4
LinkDB All DBs
Position
2:1288897..1290495
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTAHVRVVERRGDAE
RKPSFTIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVDARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIVTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTHAQTTELTGDGSKL
NGLVYKDLRSGDVNRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPAAAAQPQAEEALAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagacccaactgaaagcgtacctcgagaagatcacgcgcccg
atcgaactcgtcgcgtcgctcgacgacagcgcgaaatcgcaggaactgctcgcgctgctg
aacgagattgcgtcgctgaccgcccacgtgcgcgtcgtcgagcgccgcggcgacgccgag
cgcaagccgtcgttcacgatcggcgagcccggcaagccggccggcatccgcttcgcgggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagaccggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgatgcgcgccagatcatggccgtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgataccggcgccggc
gcgcgcgccgcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
gggccggccggcgcggcggcggcgatctactcggcgcgcaagggcatcgtgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaaattcgcgaccgcgctcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcatcctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgtaaccgcggcgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggcggcggc
aactcgggcgtcgaggcggcgatcgatctcgccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcgcagctgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcacgcgcagaccaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgctcgggcgacgtgaaccgcatcgatctcgaaggt
gtgttcgtgcagatcggcctcgtgccgaataccgaatggctgaaaggcacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgccgggcgtgttc
gccgccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggt
gcgaaggcatcgctcggcgcgttcgatcacctgatccggcaggatgcgacgccggcggcg
gccgcgcagccgcaggccgaggaagcgctcgccgcgtaa

DBGET integrated database retrieval system