KEGG   Burkholderia dolosa: AK34_4485Help
Entry
AK34_4485         CDS       T03793                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00020  Citrate cycle (TCA cycle)
bdl00190  Oxidative phosphorylation
bdl00650  Butanoate metabolism
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
bdl01200  Carbon metabolism
Module
bdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bdl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK34_4485
   00650 Butanoate metabolism
    AK34_4485
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AK34_4485
Enzymes [BR:bdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AK34_4485
    1.3.5.4  fumarate reductase (quinol)
     AK34_4485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: AJY10804
UniProt: A2WDT5
LinkDB All DBs
Position
2:complement(1547637..1548338)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEVYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKALDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMTHFFNQYHSIKPYLIND
APPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcatttttgaagtctaccgctacgatccggacaaggacgcggcaccgcgc
atgcagacgtacgagctcgagatccagcatgaacgcatgctgctcgacgcactggtcaag
ctgaaggcactggacgagacgctgtcgttccgccgttcgtgccgcgaaggcgtgtgcggt
tcggacgcgatgaacatcaacggcaagaacggtctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgcccgctgccgggcctgcccgtcgtgcgcgacctgatc
gtcgacatgacgcacttcttcaaccagtatcactcgatcaagccgtacctgatcaacgac
gcgccgccgccggagaaggagcgtctgcagtcgccggaagagcgcgacgagctcgacggc
gtgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaac
ccggacaagttcgtcggcccggccggcctgctgcaggcttaccgcttcatcgcggacagc
cgcgatacggcgaccggcgagcgtctcgacaatctggaagacccgtaccgtctgttccgt
tgccatacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaactgatggtccgccgcgcggtttaa

DBGET integrated database retrieval system