KEGG   Burkholderia dolosa: AK34_4486Help
Entry
AK34_4486         CDS       T03793                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00020  Citrate cycle (TCA cycle)
bdl00190  Oxidative phosphorylation
bdl00650  Butanoate metabolism
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
bdl01200  Carbon metabolism
Module
bdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bdl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK34_4486 (sdhA)
   00650 Butanoate metabolism
    AK34_4486 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AK34_4486 (sdhA)
Enzymes [BR:bdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AK34_4486 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AK34_4486 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 HI0933_like Lycopene_cycl GIDA Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJY10453
UniProt: A2WDT4
LinkDB All DBs
Position
2:complement(1548360..1550135)
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKKQKEHKPLPADAGEFSLARLNKLDKSSSGEYTQDVANDIRATMQKHAGVFRTS
ALLKEGVELMDGLKQRVEHIHLKDKSKVFNTARVEALELENLIEVARATMVSAEARKESR
GAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQMKPLTVESVPPKPRTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctcccgcgtcgcaagttcgacgtcgtgatcgtcggcgcg
ggcggctccggcttgcgcgcggcgctgcaactgtcgcgtgcgggcctgtcggtcggcgtg
ctgtcgaaggtgtttccgacccgctcgcacacggtggccgcgcagggcggcatcggcgcg
tcgctcggcaacatgagcgaagacaactggcacttccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcaatcgaattcatgtgccgtgaagcgccgaacgtc
gtgtacgagctcgagcacttcgggatgccgttcgaccgcaacgcggacggcacgatctat
cagcgtccgttcggcggccacaccgcgaactacggcgagaagccggtccagcgcgcgtgc
gcggcggccgaccgtaccggccacgcgctgctgcacacgctgtaccagcagaacgtcgaa
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggcgctcgaaatggaaaccggcgacgtctacatcatggaaggc
aagacgacgctgttcgcgacgggcggcgcgggccggatcttcgcggcgtcgacgaacgcg
ttcatcaacaccggcgacggtctcgggatggccgcgcgtgcgggcatcgcgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcattctgcgcaacgcgaacggcgagcgcttcatggagcgc
tatgcgccgacgctgaaggatctggcgccgcgcgatttcgtgtcgcgttcgatggaccag
gaaatcaaggaaggccgcggcgtcggtccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggagccgattccggtcgtcccgacgatccactaccag
atgggcggcatcccgaccaacatccacggtcaggtcgtcggcacgtcgcgcgatcacaag
gagccggtcaacggcttctacgcggtcggcgaatgctcgtgcgtgtcggtgcacggcgcg
aaccgtctcggcacgaactcgctgctcgacctcgtggtgttcggccgtgcggccggcaac
cacatcgtcgagcacgtgaagaagcagaaggagcacaagccgctgccggccgacgcaggc
gagttctcgctggcgcgcctgaacaagctcgacaagtcgagctcgggcgaatacacgcag
gacgtcgcgaacgacatccgcgcgacgatgcagaagcacgcgggcgtgttccgcacgtcg
gcgctgctgaaggaaggcgtcgaactgatggacggcctgaagcagcgtgtcgagcacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgagctggag
aacctgatcgaggtcgcacgcgcgacgatggtgtcggccgaagcgcgcaaggaaagccgc
ggcgcgcacgcgcacagcgactacgagcaccgcgacgacgaaaactggctgcgtcacacg
ctgtggtacagcgaaggcgaccgcctcgactacaagcccgttcaaatgaagccgctgacg
gtcgaatccgtgccgccgaagccgcgcacgttctaa

DBGET integrated database retrieval system