KEGG   Burkholderia dolosa: AK34_4572Help
Entry
AK34_4572         CDS       T03793                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AK34_4572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bdl02000]
    AK34_4572
Enzymes [BR:bdl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AK34_4572
Transporters [BR:bdl02000]
 Other Transporters
  Pores ion channels [TC:1]
   AK34_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJY10515
UniProt: A0A0D5IUM6
LinkDB All DBs
Position
2:1649097..1649765
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELDVPYEIVRYERDPKTMLAPPALRAIHPLGKSPVVTDDG
RTFAESGAIVEYLVERYGNGRLAPRPGTPERHDYTYWLHYAEGSAMPPLLLKLVALRIAH
APMPFFARPIARKIAATLQSGFVDPQIALHLRHIDDALARTGWFVGDDFSAADIQMSFPL
EAATARGDGGRHPAIARFLAAIHARPAYRRALERGGPYELLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcacctgaacaactcgcgctcgcagcgcgtgctgtggctgctcgaa
gaactggatgtgccgtacgagatcgtgcgctacgagcgcgatccgaagacgatgctcgcg
ccgcccgcgctgcgggcgatccatccgctcggcaagtcgcccgtcgtgaccgacgacggc
cgcacgttcgccgaatcgggcgcgatcgtcgaatacctggtcgaacgctacggcaacggc
cgcctcgcgccgcggccgggcacgccggagcggcacgactacacgtactggctgcactat
gcggaaggttcggcgatgccgccgctgctgctcaagctcgtcgcactgcggatcgcgcac
gcgccgatgccgttcttcgctcgaccgatcgcgcgcaagatcgcggcgacgctgcagtcg
ggtttcgtcgatccgcagatcgcgctgcatctgcgccatatcgacgacgcgctcgcgcgc
acgggctggttcgtcggcgacgacttcagtgcagccgacatccagatgagctttccgctc
gaagccgcgacggcgcgcggcgacggcggccggcatccggcgatcgcccgctttctcgcc
gcgatccacgcgcgccccgcgtatcggcgggcgctcgagcgcggcggtccgtacgaactg
ctcaaatag

DBGET integrated database retrieval system