KEGG   Burkholderia dolosa: AK34_5285Help
Entry
AK34_5285         CDS       T03793                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bdl  Burkholderia dolosa
Pathway
bdl00010  Glycolysis / Gluconeogenesis
bdl00052  Galactose metabolism
bdl01100  Metabolic pathways
bdl01110  Biosynthesis of secondary metabolites
bdl01120  Microbial metabolism in diverse environments
bdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AK34_5285
   00052 Galactose metabolism
    AK34_5285
Enzymes [BR:bdl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AK34_5285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Pcc1
Motif
Other DBs
NCBI-ProteinID: AJY11276
UniProt: A0A0D5IWJ2
LinkDB All DBs
Position
3:complement(263923..265086)
Genome map
AA seq 387 aa AA seqDB search
MKRPWTRRPLLAIYALATFGFGSVAASAAPDVSIARADYGKTASGQAVSRYTLANARGVT
LRVITYGGIVTNLDVPDRTGRIADIVLGFDSLRDYEAHNGNIHFGALIGRYANRIAGGRF
SLDGTTWQLPVNDGPNTLHGGPDSFDAKVWTVVGTRSDATSASVTLRYVSPDGENGFPGT
LTTDVTYTLTGDNVIRIDYRATTDKDTVVNLTNHSYFNLAGHDRGSVEHQLIEIAASRFT
PTDATSIPTGQLADVGGTPMDLREPTPIGARLRSAYPQLVIAHGYDQNWVLDRGGRSTPE
FAARAYDPASGRFLELYTTQPGLQFYTSNGLNGSVVGKGGTVYRQTDAFALEAEHFPDSP
NHPSFPTTVLKAGQTLHEVTLWKVGAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaccctggacgcgacgcccgctgctcgcgatctatgcgctcgcaacgttcgga
ttcggcagcgtcgcggcgtcggcggcgcccgacgtgtccatcgcgcgcgcggactacggg
aagaccgcatccggacaggcagtgagccgctacacgctcgcgaacgcgcgcggcgtgacg
ctgcgggtgatcacgtacggcggcatcgtcacgaatctcgacgtgccggatcggacgggc
aggatcgccgacatcgtgctcggcttcgattcgttgcgcgattacgaagcgcacaacggc
aatatccatttcggcgcgttgatcggccgctatgcgaaccggatcgcgggcgggcgcttt
tcgctcgacggcacgacgtggcagctgccggtcaacgacggcccgaatacgctgcacggc
ggccccgacagtttcgatgcgaaggtgtggacggtggtcggcacgcgcagcgacgcgacg
agcgcgagcgtcacgctgcgctatgtgagccccgacggagagaacggctttcccggtacg
ctgacgaccgacgtgacctacacgctgaccggcgacaacgtgatacgcatcgactatcgc
gcgacgacggacaaggacacggtcgtcaacctgacgaaccacagctatttcaatctggcc
gggcacgatcgcggcagtgtcgagcatcagctgatcgagatcgccgcgtcgcgctttacg
ccgaccgacgcgacgtcgattccgaccgggcagctggcggacgtcggcggcacgccgatg
gatctgcgcgagccgacgccgatcggcgcgcgtctgcgcagtgcatatccgcaactcgtc
atcgcgcacggctacgaccagaactgggtgctcgaccgcggcggccgatcgacgccggaa
tttgccgcgcgcgcgtacgacccggcgtcgggacgtttcctcgagctgtatacgacgcag
ccggggctgcagttctatacgtccaacgggctgaacggcagcgtcgtcggcaagggcggc
accgtttatcggcagacggacgcgttcgcgctcgaggcggaacattttcccgattcgccg
aaccatccgtcgttcccgacgaccgtgctgaaggccggacagacgctgcacgaggtgacg
ttgtggaaggtcggcgcgcgttga

DBGET integrated database retrieval system