KEGG   Brevundimonas diminuta: EQG53_01090Help
Entry
EQG53_01090       CDS       T05851                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
bdm  Brevundimonas diminuta
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EQG53_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: QAT13062
UniProt: A0A410NT83
LinkDB All DBs
Position
complement(226759..227553)
Genome map
AA seq 264 aa AA seqDB search
MDLSPLQYGLGAGAGSLVGFTLGLVGGGGSILAVPLIVYLVGVKEPHLAIGTSAFAVAAN
AFANVINHARHGTVKWKIASLFAVAGVLGAFLGSSLGKAVDGQKLLALFAVLMLVVGVLM
LRGRSAGGDPNVQLDRRNAPKLVGTGLATGVMSGFFGIGGGFLIVPSLMFSTRMPIYYAV
GSSLVGVTAFGLTTAFNYALDGWVDWPLAAVFIGGGVLGGLVGARLAKALSGQKGVLNTV
FAGLIFVVAFYMLYRSAGALGLIG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtctccgctgcagtacggcctcggcgccggcgccggctcgctcgtcggcttc
accctgggcctggtcggcggcggcgggtccatcctggccgtgccgctgatcgtctatctg
gtcggggtcaaggagccgcatctggcgatcggcaccagcgccttcgccgtggccgccaac
gccttcgccaatgtgatcaatcatgcccgccacggcacggtgaaatggaaaatcgccagt
ctgttcgcggtcgctggggtgctcggagcctttctgggttcgagcctgggcaaggccgtg
gacggtcagaagctgctggcccttttcgccgtcctgatgcttgtcgtcggggtgctgatg
ttgcggggccgctccgccggcggtgacccgaacgtccagcttgatcgccgcaatgcaccc
aagctcgtcggcacgggcctggccacgggcgtgatgtcgggcttcttcggcatcggcggc
ggcttcctgatcgtgcccagcctgatgttctcgacccggatgccgatctattatgcggtt
ggctcatcgcttgtcggcgtcaccgccttcggcctgaccacggccttcaactacgctctg
gacggctgggtcgactggcccctggcggcggtgttcatcggcggcggcgttttggggggc
ctcgtcggcgcgcggttggccaaggcgctgtcgggacaaaaaggcgtcttgaacaccgtc
ttcgccgggctgatcttcgtcgtcgccttctatatgctttaccgcagcgccggcgcgctc
ggcctgatcgggtga

DBGET integrated database retrieval system