KEGG   Brevundimonas diminuta: EQG53_03700Help
Entry
EQG53_03700       CDS       T05851                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bdm  Brevundimonas diminuta
Pathway
bdm00020  Citrate cycle (TCA cycle)
bdm00190  Oxidative phosphorylation
bdm00650  Butanoate metabolism
bdm01100  Metabolic pathways
bdm01110  Biosynthesis of secondary metabolites
bdm01120  Microbial metabolism in diverse environments
bdm01130  Biosynthesis of antibiotics
bdm01200  Carbon metabolism
Module
bdm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bdm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bdm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EQG53_03700
   00650 Butanoate metabolism
    EQG53_03700
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EQG53_03700
Enzymes [BR:bdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EQG53_03700
    1.3.5.4  fumarate reductase (quinol)
     EQG53_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_oxidored Thi4 DAO HI0933_like Pyr_redox_3 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QAT13532
UniProt: A0A410NUJ1
LinkDB All DBs
Position
728175..729959
Genome map
AA seq 594 aa AA seqDB search
MAAYELIDHEYDVVVVGAGGSGLRAALGAAQQGLKVACVTKVFPTRSHTVAAQGGISASL
GNMGEDSWQWHMYDTVKGSDWLGDQDAIEYLVRNAPQAVYELEHWGVPFSRTDEGKIYQR
AFGGMTRNFGEGPVQRTCAAADRTGHAILHTLYGQSVRREVKFFIEYFALDLIMQDGACT
GVTALQLDTGQLHQFRAKMVVLATGGYGRAYFSATSAHTCTGDGNAMVLRAGLPLQDMEF
VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRSMTIEIR
EGRGVGPNKDHIFLHLDHLDPKILHARLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG
IPTNYHGEVLTLRDGNPDSVVPGLMAVGEAACVSVHGANRLGSNSLTDLVVFGRAVGLRC
GEVVDKNSAVPSASKAQTDEHLARLDRFRNASGSTPTAHLRLDMQRAMQADAAVFRTGKT
LDEGVQKLRSIDAAGSDIKTTDRGLIWNTDLVETLEYDNLIAQALVTIEGAANRTESRGA
HAREDYPDRDDVNWMKHTLAWKRPGEGVQIDYRPVHKYTMTDEVSYIEPKARVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacgagcttatcgatcacgaatacgacgtcgtcgtcgtcggcgccgggggc
tccggcctgcgcgccgccctcggcgccgcccagcagggcctgaaggtcgcctgcgtcacc
aaggtcttccccacacggagccacaccgtggcggcccagggcggcatctccgcctcgctc
ggcaacatgggcgaggacagctggcagtggcacatgtacgacaccgtcaaggggtcggac
tggctgggcgaccaggacgccatcgaatacctggtccgcaacgcgccgcaggccgtttac
gagctggaacactggggcgtgcccttcagccgcaccgacgaaggcaagatctatcagcgc
gccttcggcggcatgacccgcaacttcggcgaaggcccggtgcagcgcacctgcgccgcc
gccgaccgcaccggccacgccatcctgcacaccctgtacggccagtcggtccgtcgcgag
gtgaagttcttcatcgagtatttcgcgctggacctgatcatgcaggacggcgcctgcacc
ggcgtcaccgcgcttcagctcgacaccggccagttgcaccagttccgcgccaagatggtg
gtgctggcgaccggcggttacggccgcgcctatttctcggccacctcggcccacacctgc
acaggcgacggcaacgccatggtgctgcgcgccggcctgccgctgcaggacatggagttc
gtgcagttccacccgaccggcatctacggcgccggctgcctcatcaccgagggcgcccgc
ggtgaaggcggctatctgaccaactccgagggcgagcgcttcatggagcgctatgcgccg
accgtgaaggatctggccccgcgcgacatggtcagccgctccatgaccatcgaaatccgc
gaaggccgcggcgtgggcccgaacaaggaccacatcttcctgcatctggatcacctggac
ccgaagatcctgcacgcgcgcctgccgggcatctcggaatcggccaagatcttcgccggc
gtcgatgtgaccaaggagccgatcccggtcctgccgaccgtccactacaacatgggcggc
atcccgacgaactatcacggcgaggtgctgacgctgcgcgacggcaaccccgacagcgtg
gttccgggcctgatggccgtaggcgaagccgcctgcgtctcggtgcacggcgccaaccgt
ctgggctccaactccctgaccgacctggtggtgttcggccgcgccgtcggcctgcgctgc
ggcgaggtcgtggacaagaactcggccgtgccctcggcctccaaggcccagacggacgag
cacctggcgcgcctggaccgcttccgcaacgcctcgggctcgacccccacggcgcacctg
cgtctggacatgcagcgcgccatgcaggccgacgccgccgtcttccgcaccggcaagacc
ctggacgaaggcgtccagaagctgcgctcgatcgacgccgccggctcggacatcaagacc
acggaccgcggcctgatctggaacacggacctggtggagacgctggagtacgacaacctg
atcgcccaggccctagtcaccatcgaaggcgcggccaaccgcacggaatcgcgcggcgcc
cacgcccgcgaggactacccggaccgcgacgacgtcaactggatgaagcacaccctggcg
tggaagcgtccgggcgaaggcgtccagatcgactaccgtccggtgcacaaatacacgatg
accgacgaggtctcgtacatcgagcccaaggctcgggtttactaa

DBGET integrated database retrieval system